Overview

  • Product name
    Anti-MTTP antibody - C-terminal
    See all MTTP primary antibodies
  • Description
    Rabbit polyclonal to MTTP - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Dog, Human, Pig
  • Immunogen

    Synthetic peptide within Human MTTP aa 663-712 (C terminal). The exact sequence is proprietary.
    Sequence:

    QVVIEAQGLEALIAATPDEGEENLDSYAGMSAILFDVQLRPVTFFNGYSD


    Database link: P55157

  • Positive control
    • Mouse liver lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab186446 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 99 kDa.

Target

Images

  • Anti-MTTP antibody - C-terminal (ab186446) at 1 µg/ml + Mouse liver lysate at 10 µg

    Predicted band size: 99 kDa

References

This product has been referenced in:
  • Sheldon RD  et al. Chronic NOS inhibition accelerates NAFLD progression in an obese rat model. Am J Physiol Gastrointest Liver Physiol 308:G540-9 (2015). Read more (PubMed: 25573175) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186446.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up