Anti-Mu Opioid Receptor antibody (ab177898)

Overview

  • Product name
    Anti-Mu Opioid Receptor antibody
    See all Mu Opioid Receptor primary antibodies
  • Description
    Rabbit polyclonal to Mu Opioid Receptor
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Sheep, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Pig, Chimpanzee, Zebrafish
  • Immunogen

    Synthetic peptide within Mouse Mu Opioid Receptor aa 251-300 (internal sequence). The exact sequence is proprietary. Isoform 11
    Sequence:

    CYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV


    Database link: P42866-11

  • Positive control
    • Mouse brain lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab177898 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 49 kDa.

Target

Images

  • Anti-Mu Opioid Receptor antibody (ab177898) at 1 µg/ml + Mouse brain lysate at 10 µg

    Predicted band size : 49 kDa

References

ab177898 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177898.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up