Overview

  • Product nameAnti-MYBPH antibody
    See all MYBPH primary antibodies
  • Description
    Rabbit polyclonal to MYBPH
  • Tested applicationsSuitable for: WB, Immunomicroscopymore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 107-156,

    LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP

    , of Human MYBPH (NP_004988).

  • Positive control
    • HeLa cell lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab98187 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 52 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
Immunomicroscopy Use at an assay dependent concentration. PubMed: 24184715

Target

  • FunctionBinds to myosin; probably involved in interaction with thick myofilaments in the A-band.
  • Tissue specificitySkeletal muscle.
  • Sequence similaritiesBelongs to the immunoglobulin superfamily. MyBP family.
    Contains 2 fibronectin type-III domains.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Information by UniProt
  • Database links
  • Alternative names
    • bHLHe38 antibody
    • H protein antibody
    • H-protein antibody
    • l-myc protein antibody
    • l-myc-1 proto-oncogene antibody
    • LMYC antibody
    • MyBP H antibody
    • MyBP-H antibody
    • Mybph antibody
    • MYBPH_HUMAN antibody
    • myc-related gene from lung cancer antibody
    • MYCL antibody
    • Myosin binding protein H antibody
    • Myosin binding protein, 86-KD antibody
    • Myosin-binding protein H antibody
    • Oncogene lmyc antibody
    • V-myc avian myelocytomatosis viral oncogene homolog 1, lung carcinoma derived antibody
    see all

Anti-MYBPH antibody images

  • Anti-MYBPH antibody (ab98187) at 1 µg/ml (n 5% skim milk / PBS buffer) + HeLa Cell Lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 52 kDa

References for Anti-MYBPH antibody (ab98187)

This product has been referenced in:
  • Conti A  et al. Increased expression of Myosin binding protein H in the skeletal muscle of amyotrophic lateral sclerosis patients. Biochim Biophys Acta 1842:99-106 (2014). IP ; Human . Read more (PubMed: 24184715) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab98187.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"