Overview

  • Product name
    Anti-MYBPH antibody
  • Description
    Rabbit polyclonal to MYBPH
  • Tested applications
    Suitable for: WB, Immunomicroscopymore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 107-156,

    LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP

    , of Human MYBPH (NP_004988).

  • Positive control
    • HeLa cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab98187 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 52 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
Immunomicroscopy Use at an assay dependent concentration. PubMed: 24184715

Target

  • Function
    Binds to myosin; probably involved in interaction with thick myofilaments in the A-band.
  • Tissue specificity
    Skeletal muscle.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. MyBP family.
    Contains 2 fibronectin type-III domains.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Information by UniProt
  • Database links
  • Alternative names
    • bHLHe38 antibody
    • H protein antibody
    • H-protein antibody
    • l-myc protein antibody
    • l-myc-1 proto-oncogene antibody
    • LMYC antibody
    • MyBP H antibody
    • MyBP-H antibody
    • Mybph antibody
    • MYBPH_HUMAN antibody
    • myc-related gene from lung cancer antibody
    • MYCL antibody
    • Myosin binding protein H antibody
    • Myosin binding protein, 86-KD antibody
    • Myosin-binding protein H antibody
    • Oncogene lmyc antibody
    • V-myc avian myelocytomatosis viral oncogene homolog 1, lung carcinoma derived antibody
    see all

Images

  • Anti-MYBPH antibody (ab98187) at 1 µg/ml (n 5% skim milk / PBS buffer) + HeLa Cell Lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 52 kDa

References

This product has been referenced in:
  • Conti A  et al. Increased expression of Myosin binding protein H in the skeletal muscle of amyotrophic lateral sclerosis patients. Biochim Biophys Acta 1842:99-106 (2014). IP ; Human . Read more (PubMed: 24184715) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab98187.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up