Anti-Mycobacterium tuberculosis 16kDa antibody (FITC) (ab193421)

Overview

  • Product name
    Anti-Mycobacterium tuberculosis 16kDa antibody (FITC)
    See all Mycobacterium tuberculosis 16kDa primary antibodies
  • Description
    Rabbit polyclonal to Mycobacterium tuberculosis 16kDa (FITC)
  • Host species
    Rabbit
  • Conjugation
    FITC. Ex: 493nm, Em: 528nm
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity

    Predicted to work with: Other
  • Immunogen

    Recombinant full length protein corresponding to Mycobacterium tuberculosis 16kDa aa 30-159.
    Sequence:

    AYPITGKLGSELTMTDTVGQVVLGWKVSDLKSSTAVIPGYPVAGQVWEAT ATVNAIRGSVTPAVSQFNARTADGINYRVLWQAAGPDTISGATIPQGEQS TGKIYFDVTGPSPTIVAMNNGMEDLLIWEP


    Database link: P9WIP1

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C. Store In the Dark.
  • Storage buffer
    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity
    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab193421 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/50 - 1/200. Predicted molecular weight: 17 kDa.

Target

  • Relevance
    Mycobacterium tuberculosis is the most common cause of tuberculosis. Primary infection begins with inhalation of 1 to 10 aerosolised bacilli. The pathogenicity of the organism is determined by its ability to escape host immune responses as well as eliciting delayed hypersensitivity. Alveolar macrophages engulf the invading cells but are unable to mount an effective defense. Several virulence factors are responsible for this apparent failure; most notably in the mycobacterial cell wall are the cord factor, lipoarabinomannan, and the 65 kd heat shock protein or HSP65. The emergence of new strains of resistant Mycobacterium tuberculosis has created new interest in clinical diagnosis. Studies have shown immunohistochemical techniques to be superior to conventional special stains. Thus the demonstration of mycobacterial antigens are not only useful in establishing mycobacterial aetiology, but can also be used as an alternative method to the conventional Ziehl-Neelsen method.
  • Cellular localization
    Secreted
  • Alternative names
    • 16 kDa antigen antibody
    • 16 kDa immunoprotective extracellular protein antibody
    • Antigen MPT63 antibody
    • MT1977 antibody
    • MTCY09F9.38 antibody
    • Rv1926c antibody
    see all

References

ab193421 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193421.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up