• Product nameAnti-MYL6 antibody
    See all MYL6 primary antibodies
  • Description
    Rabbit polyclonal to MYL6
  • Tested applicationsSuitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 71 - 120 (PMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKM T) of Human MYL6 (NP_524147)

  • Positive control
    • HepG2 cell lysate

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Our Abpromise guarantee covers the use of ab84349 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 5 µg/ml.
WB Use a concentration of 1 µg/ml. Detects a band of approximately 17 kDa (predicted molecular weight: 17 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 5 µg/ml.

Anti-MYL6 antibody images

  • Anti-MYL6 antibody (ab84349) at 1 µg/ml (in 5% skim milk / PBS buffer) + HepG2 cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 17 kDa
    Observed band size : 17 kDa
  • IHC-P image of MYL6 antibody (ab84349) on seminal vesicle tissue. The sections were fixed in Paraformaldehyde and underwent heat mediated antigen retrieval using Novacastra (pH6). The sections were then blocked in 3% H2O2 solution for 10 minutes at 22°C.

    See Abreview

  • ab84349 at 5 µg/ml staining in MYL6 in Human skeletal muscle by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).
  • ab84349 staining at 5 µg/ml in MYL6 in Human prostate by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).
  • ICC/IF image of ab84349 stained HepG2 cells. The cells were 4% formaldehyde (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab84349, 5µg/ml) overnight at +4°C. The secondary antibody (green) was ab96899 Dylight 488 goat anti-rabbit IgG (H+L) used at a 1/250 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

References for Anti-MYL6 antibody (ab84349)

ab84349 has not yet been referenced specifically in any publications.

Product Wall

Abcam guarantees this product to work in the species/application used in this Abreview.
Application Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample Human Tissue sections (Seminal Vesicle)
Specification Seminal Vesicle
Fixative Paraformaldehyde
Antigen retrieval step Heat mediated - Buffer/Enzyme Used: Novocastra pH 6 retrieval buffer
Permeabilization No
Blocking step H2O2 as blocking agent for 10 minute(s) · Concentration: 3% · Temperature: 22°C

Dr. Aamir Ahmed

Verified customer

Submitted Jan 26 2011