Anti-Myogenin antibody [F5D] - BSA and Azide free (ab212667)

Overview

  • Product name
    Anti-Myogenin antibody [F5D] - BSA and Azide free
    See all Myogenin primary antibodies
  • Description
    Mouse monoclonal [F5D] to Myogenin - BSA and Azide free
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, ELISA, Flow Cyt, ICC/IF, IHC-P, IPmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Cat, Dog, Human, Pig
  • Immunogen

    This product was produced with the following immunogens:
    Synthetic peptide corresponding to Rat Myogenin aa 73-94.
    Sequence:

    CKRKSVSVDRRRAATLREKRRL


    Database link: P20428

    Recombinant fragment corresponding to Rat Myogenin aa 30-224.
    Sequence: FEPPGYERTELSLSPEARGPLEEKGLGTPEHCPGQCLPWACKV

    CKRKSVSVDRRRAATLREKRRL

    KKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEER DLRYRGGGGPSRWYPVNATPTAPPAVRSGAMHWSLVPTQEIICSQLTLQV PTTCTPLRPSWTASRWRICLSPSQMKPCPT
    Database link: P20428

  • Positive control
    • Rh-30 cells; skeletal muscle or rhabdomyosarcoma tissues

Properties

Applications

Our Abpromise guarantee covers the use of ab212667 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 1 µg/ml. Predicted molecular weight: 32 kDa.
ELISA Use at an assay dependent concentration.

(for coating)

Flow Cyt Use 0.5-1µg for 106 cells.

Final volume 100 µL.

ICC/IF Use a concentration of 0.5 - 1 µg/ml.
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

for 30 minutes at room temperature.

IP Use a concentration of 0.5 - 1 µg/ml.

Target

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human rhabdomyosarcoma tissue section labeling Myogenin with ab212667 at 1 µg/mL.

References

ab212667 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab212667.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up