Overview

  • Product name
  • Description
    Rabbit polyclonal to Myoglobin
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Pig, Chimpanzee, Cynomolgus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human Myoglobin aa 1-154.
    Sequence:

    MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHL KSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKI PVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKEL GFQG


    Database link: P02144

  • Positive control
    • BT474, 22RV-1, HepG2, Mouse liver and Mouse skeletal muscle extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab187506 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 17 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Target

Images

  • All lanes : Anti-Myoglobin antibody (ab187506) at 1/500 dilution

    Lane 1 : BT474 extract
    Lane 2 : 22RV-1 extract
    Lane 3 : HepG2 extract
    Lane 4 : Mouse liver extract
    Lane 5 : Mouse skeletal muscle extract


    Predicted band size : 17 kDa

References

ab187506 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187506.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up