Overview

  • Product nameAnti-n-Myc antibody
    See all n-Myc primary antibodies
  • Description
    Rabbit polyclonal to n-Myc
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human n-Myc aa 361-410 (C terminal).
    Sequence:

    SVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPE


    Database link: P04198

  • Positive control
    • Fetal heart lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab24339 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2.5 µg/ml. Detects a band of approximately 50 kDa (predicted molecular weight: 50 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMay function as a transcription factor.
  • Involvement in diseaseNote=Amplification of the N-MYC gene is associated with a variety of human tumors, most frequently neuroblastoma, where the level of amplification appears to increase as the tumor progresses.
    Defects in MYCN are the cause of microcephaly-oculo-digito-esophageal-duodenal syndrome (MODED) [MIM:164280]; also known as oculodigitoesophagoduodenal syndrome (ODED). Microcephaly-oculo-digito-esophageal-duodenal syndrome is characterized by variable combinations of esophageal and duodenal atresias, microcephaly, learning disability and limb malformations. Cardiac and renal malformations, vertebral anomalies, and deafness have also been described.
    Defects in MYCN are the cause of microcephaly and digital abnormalities with normal intelligence (MCPHDANI) [MIM:602585].
  • Sequence similaritiesContains 1 basic helix-loop-helix (bHLH) domain.
  • Developmental stageExpressed during fetal development.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • bHLHe37 antibody
    • Class E basic helix-loop-helix protein 37 antibody
    • MODED antibody
    • mycn antibody
    • MYCN_HUMAN antibody
    • N myc antibody
    • N myc proto oncogene protein antibody
    • N-myc proto-oncogene protein antibody
    • Neuroblastoma derived v myc avian myelocytomatosis viral related oncogene antibody
    • Neuroblastoma MYC oncogene antibody
    • NMYC antibody
    • NMYC proto oncogene protein antibody
    • ODED antibody
    • Oncogene NMYC antibody
    • pp65/67 antibody
    • v myc avian myelocytomatosis viral related oncogene neuroblastoma derived antibody
    • v myc myelocytomatosis viral related oncogene neuroblastoma derived antibody
    see all

Anti-n-Myc antibody images

  • Anti-n-Myc antibody (ab24339) at 2.5 µg/ml + Fetal heart lysate

    Secondary
    HRP-conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 50 kDa
    Observed band size : 50 kDa

References for Anti-n-Myc antibody (ab24339)

ab24339 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your enquiry. Following an alignment of the immunogen sequence with the woodchuck sequence that you have provided me with I can tell you that there was no sequence similarity and therefore I predict that this antibody would not react ...

Read More

Thank you for your enquiry. Unfortunately the immunogen sequence used to raise n-Myc antibody (ab24339) remains proprietary. It was a synthetic peptide corresponding to a region of Human MYCN. However, if you provide me with the sequence or Swiss-Pr...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"