Overview

  • Product name
  • Description
    Rabbit polyclonal to NAIF1
  • Tested applications
    Suitable for: ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human NAIF1 aa 165-247.
    Sequence:

    TVTLTQIPTETTYHTLEEGVVEYCTAEAPPPLPPETPVDMMAQHADTSVK PQALKSRIALNSAKLIQEQRVTNLHVKEIAQHL


    Database link: Q69YI7

  • Positive control
    • A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220716 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
Fixation/Permeabilization: PFA/Triton X-100.

Target

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized A431 cells labeling NAIF1 with ab220716 at 4 μg/ml (green).

References

ab220716 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220716.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up