Overview

  • Product name
  • Description
    Goat polyclonal to NAP1L4
  • Tested applications
    Suitable for: Neutralising, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NAP1L4 aa 59-128 (C terminal).
    Sequence:

    AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDP DAPRIKKIVQKKLAGDESAD


    Database link: P02775

Properties

Applications

Our Abpromise guarantee covers the use of ab194644 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Neutralising Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 14 kDa.

Target

  • Relevance
    This gene encodes a member of the nucleosome assembly protein (NAP) family which can interact with both core and linker histones. It can shuttle between the cytoplasm and nucleus, suggesting a role as a histone chaperone. This gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer.
  • Cellular localization
    Nuclear
  • Database links
  • Alternative names
    • NAP2 antibody
    • Nucleosome assembly protein 1-like 4 antibody
    • Nucleosome assembly protein 2 antibody

References

ab194644 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194644.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up