Native Cow Bovine Serum Albumin protein (ab192596)

Overview

Description

  • Nature
    Native
  • Source
    Native
  • Amino Acid Sequence
    • Accession
    • Species
      Cow
    • Sequence
      DTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFA KTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEPERNE CFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYA PELLYYANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCA SIQKFGERALKAWSVARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLL ECADDRADLAKYICDNQDTISSKLKECCDKPLLEKSHCIAEVEKDAIPEN LPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSRRHPEYAVSVLLRLAK EYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFEKLGEY GFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTED YLSLILNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKA FDEKLFTFHADICTLPDTEKQIKKQTALVELLKHKPKATEEQLKTVMENF VAFVDKCCAADDKEACFAVEGPKLVVSTQTALA
    • Molecular weight
      66 kDa
    • Amino acids
      25 to 607
    • Additional sequence information
      Carboxy-methyl Lysine modified.

Specifications

Our Abpromise guarantee covers the use of ab192596 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.4
    Preservative: 0.01% Sodium azide
    Constituents: 48% PBS, 50% Glycerol, 0.87% Sodium chloride, 0.01% EDTA

General Info

  • Alternative names
    • alb
    • ALBU_HUMAN
    • Albumin
    • Albumin (32 AA)
    • Albumin (AA 34)
    • BSA
    • Cell growth inhibiting protein 42
    • Growth inhibiting protein 20
    • PRO0883
    • PRO0903
    • PRO1341
    • Serum albumin
    see all
  • Information by UniProt

References

ab192596 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192596.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up