Native Rat Heme Oxygenase 1 protein (ab222786)

Overview

Description

  • Nature
    Native
  • Source
    Native
  • Amino Acid Sequence
    • Accession
    • Species
      Rat
    • Sequence
      MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLV MASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPH WQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGDLSGGQVLKKI AQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVT EEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSA ETPRGKSQISTSSSQTPLLRWVLTLSFLLATVAVGIYAM
    • Molecular weight
      33 kDa
    • Amino acids
      1 to 289
    • Additional sequence information
      NP_036712.1.

Specifications

Our Abpromise guarantee covers the use of ab222786 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab222786 was ion-exchange purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.50
    Constituents: 0.003% EDTA, 0.1% Triton-X-100, 0.38% Potassium chloride, 0.24% Tris, 0.2% sodium cholate hydrate

General Info

  • Alternative names
    • 32 kD
    • bK286B10
    • D8Wsu38e
    • Heat shock protein
    • heat shock protein 32 kD
    • heat shock protein 32kD
    • Heme oxygenase (decycling) 1
    • Heme oxygenase 1
    • Hemox
    • Hmox
    • HMOX 1
    • Hmox1
    • HMOX1_HUMAN
    • HO
    • HO 1
    • HO-1
    • HO1
    • Hsp32
    see all
  • Function
    Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed.
  • Sequence similarities
    Belongs to the heme oxygenase family.
  • Cellular localization
    Microsome. Endoplasmic reticulum.
  • Information by UniProt

References

ab222786 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222786.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up