Overview

  • Product name
    Anti-Natriuretic peptides A antibody
    See all Natriuretic peptides A primary antibodies
  • Description
    Rabbit polyclonal to Natriuretic peptides A
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human Natriuretic peptides A aa 26-151.
    Sequence:

    NPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALS PLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSL RRSSCFGGRMDRIGAQSGLGCNSFRY


    Database link: P01160

  • Positive control
    • WB: PC3 cell line extract.

Properties

Applications

Our Abpromise guarantee covers the use of ab180649 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 16 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Target

  • Function
    Hormone playing a key role in cardiovascular homeostasis through regulation of natriuresis, diuresis, and vasodilation. Also plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3.
  • Involvement in disease
    Atrial standstill 2
    Atrial fibrillation, familial, 6
  • Sequence similarities
    Belongs to the natriuretic peptide family.
  • Post-translational
    modifications
    Cleaved by CORIN upon secretion to produce the functional hormone.
    Atrial natriuretic factor: Cleaved by MME. The cleavage initiates degradation of the factor and thereby regulate its activity.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • ANF antibody
    • ANF_HUMAN antibody
    • ANP antibody
    • ATFB6 antibody
    • Atrial natriuretic factor antibody
    • Atrial natriuretic peptide antibody
    • Atriopeptin antibody
    • Cardiodilatin antibody
    • Cardiodilatin related peptide antibody
    • Cardiodilatin-related peptide antibody
    • Cardionatrin antibody
    • CDD ANF antibody
    • CDD antibody
    • CDD-ANF antibody
    • CDP antibody
    • Natriuretic peptide A antibody
    • Natriuretic peptide precursor A antibody
    • NPPA antibody
    • PND antibody
    • Prepronatriodilatin antibody
    see all

Images

  • Anti-Natriuretic peptides A antibody (ab180649) at 1/500 dilution + Mouse heart tissue lysate

    Predicted band size : 16 kDa
    Primary: ab180649, 1/500 dilution, Lane 1: Mouse heart tissue lysate.

References

This product has been referenced in:
  • Holloway TM  et al. High intensity interval and endurance training have opposing effects on markers of heart failure and cardiac remodeling in hypertensive rats. PLoS One 10:e0121138 (2015). WB ; Rat . Read more (PubMed: 25803693) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180649.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up