Overview

  • Product name
    Natural alpha-hemolysin protein
  • Protein length
    Full length protein

Description

  • Nature
    Native
  • Source
    Native
  • Amino Acid Sequence
    • Accession
    • Sequence
      ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNK KLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISD YYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQ PDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTR NGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYE RVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN
    • Molecular weight
      33 kDa
    • Amino acids
      27 to 319
    • Additional sequence information
      From Staphylococcus aureus. This product is for the mature full length protein from aa 27 to 319. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab192009 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    One hemolytic unit will cause 50% lysis of a 1% suspension of rabbit red blood cells in phosphate buffered saline, pH 7.0, containing 1% bovine serum albumin after 30 min at 37 °C followed by refrigeration for 30 min at 4 °C.

    Extinction Coefficient: E= 11 (280 nm)

    pI: 8.5

  • Applications

    Functional Studies

  • Form
    Lyophilised
  • Additional notes

    This protein is derived from a pathogenic organism, and may be involved in a disease process, consequently exposure may have adverse health effects. Derived from Staphylococcus aureus.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C.

    Constituent: 0.03% Sodium citrate

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Soluble in deionized water (0.5 mg/ml), yielding a colorless, faint hazy solution

General Info

  • Alternative names
    • Alpha-HL
    • Alpha-toxin
    • hla
    • hly
  • Relevance
    Alpha-toxin binds to the membrane of eukaryotic cells resulting in the release of low-molecular weight molecules and leading to an eventual osmotic lysis. Heptamer oligomerization and pore formation is required for lytic activity.
  • Cellular localization
    Secreted. Note: Secreted as a monomer. After oligomerization and pore formation, the complex is translocated across the bilayer, probably via the Gly-rich domain of each strand.

References

ab192009 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192009.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up