Natural Human Apolipoprotein CII (ab167799)

Overview

Description

  • Nature
    Native
  • Source
    Native
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLR DLYSKSTAAMSTYTGIFTDQVLSVLKGEE
    • Molecular weight
      9 kDa
    • Amino acids
      23 to 101

Specifications

Our Abpromise guarantee covers the use of ab167799 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C.

    pH: 7.40
    Constituent: 0.08% Ammonium bicarbonate

  • Reconstitution
    Reconstitute with 0.2 ml reagent grade water to product 0.25 mg/ml

General Info

  • Alternative names
    • APC 2
    • APC2
    • Apo CII
    • APOC 2
    • ApoC II
    • APOC2
    • APOC2 protein
    • APOC2_HUMAN
    • ApoCII
    • Apolipoprotein C II
    • Apolipoprotein C II precursor
    • Apolipoprotein C2
    • ApolipoproteinCII
    • MGC75082
    see all
  • Relevance
    At least 9 distinct polymorphic forms of apolipoproteins are known. The apolipoproteins act as stabilizers of the intact lipoprotein particles. Quantitative measurements of HDL, LDL and VLDL particles in human serum are often used to estimate an individuals' relative risk of coronary heart disease. In addition, quantitative immunological measurements of certain apolipoproteins (especially A-1 and B) have been suggested to be more accurate estimators of coronary heart disease than measurements of lipoprotein particles (especially HDL and LDL). Apolipoprotein C-II (apoCII) is in found in chylomicrons (large lipoprotein particles absorbed from the gastrointestinal tract) and VLDL (large lipoproteins that are broken down to eventually form LDL). ApoCII activates the enzyme lipoprotein lipase, which hydrolyzes triglycerides and thus provides free fatty acids for cells.
  • Cellular localization
    Secreted

Images

  • SDS-PAGE analysis of ab167799.

References

ab167799 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167799.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up