Natural human MMP9 protein (Proenzyme, monomer) (ab157344)

Overview

  • Product name
    Natural human MMP9 protein (Proenzyme, monomer)
    See all MMP9 proteins and peptides
  • Protein length
    Full length protein
  • Description
    Natural human MMP9 protein (Proenzyme)

Description

  • Nature
    Native
  • Source
    Native
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      APRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGP ALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHH NITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQ FGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVP TRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFG FCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTAN YDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDG RLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALM YPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCP TGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVN IFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDS VFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRS GRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYRE KAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
    • Molecular weight
      92 kDa
    • Amino acids
      20 to 707
    • Additional sequence information
      Isolated from stimulated human neutrophil granulocytes (buffy coat). Requires activation.

Specifications

Our Abpromise guarantee covers the use of ab157344 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    ≥1’400mU/mg protein (Y. Masui, et al.; Biochem. Med. 17, 215 (1977)). One unit is defined as the amount of enzyme that hydrolyzes 1µmol 2,4-dinitrophenyl-Pro-Gln-Gly-Ile-Ala-Gly-Gln-D-Arg-OH per min. at 37°C, pH 7.0.

  • Applications

    Western blot

    Functional Studies

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .
    No other MMP contaminants are detectable.
  • Form
    Liquid
  • Additional notes

    Precursor enzyme needs activation using 2 mM APMA (aminophenylmercuric acetate) for 60-120 min. or 100 µg/ml TPCK-trypsin for 30 min. at 37°C. If required trypsin can be inhibited by incubation with 1µl of 1 mg/ml aprotinin solution for 10 min. at 25°C. If working with MMP9/TIMP-1 complexes, it is recommended to use stromelysin-1 (MMP3) for activation. Incubation at 37°C for 2 hours at 40:1 (MMP9:stromelysin-1) will remove only the propeptide to give the active form of the enzyme.The active enzyme is inhibited by TIMP1 (tissue inhibitor of matrix metalloproteinase-1) and by chelators of divalent cations like EDTA or o-phenantroline.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Preservative: 0.05% Sodium azide
    Constituents: 0.05% Brij, 0.06% Calcium chloride, 0.00001% Zinc chloride, 0.79% Tris HCl, 1.17% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • 82 kDa matrix metalloproteinase-9
    • 92 kDa gelatinase
    • 92 kDa type IV collagenase
    • CLG 4B
    • CLG4B
    • Collagenase Type 4 beta
    • Collagenase type IV 92 KD
    • EC 3.4.24.35
    • Gelatinase 92 KD
    • Gelatinase B
    • Gelatinase beta
    • GelatinaseB
    • GELB
    • Macrophage gelatinase
    • MANDP2
    • Matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
    • Matrix Metalloproteinase 9
    • MMP 9
    • MMP-9
    • MMP9
    • MMP9_HUMAN
    • Type V collagenase
    see all
  • Function
    May play an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-
    -Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide.
  • Tissue specificity
    Produced by normal alveolar macrophages and granulocytes.
  • Involvement in disease
    Intervertebral disc disease
    Metaphyseal anadysplasia 2
  • Sequence similarities
    Belongs to the peptidase M10A family.
    Contains 3 fibronectin type-II domains.
    Contains 4 hemopexin repeats.
  • Domain
    The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Post-translational
    modifications
    Processing of the precursor yields different active forms of 64, 67 and 82 kDa. Sequentially processing by MMP3 yields the 82 kDa matrix metalloproteinase-9.
    N- and O-glycosylated.
  • Cellular localization
    Secreted, extracellular space, extracellular matrix.
  • Information by UniProt

Images

  • All lanes : Anti-MMP9 antibody [EP1254] (ab76003) at 5 µg/ml

    Lane 1 : Natural human MMP9 protein (dimer) (ab168863)
    Lane 2 : Natural human MMP9 protein (Proenzyme, monomer) (ab157344)
    Lane 3 : Recombinant Mouse MMP9 protein (ab39309)

    Lysates/proteins at 0.1 µg per lane.

    Secondary
    Infrared labelled goat anti-rabbit (green) antibody at 1/20000 dilution

    Performed under reducing conditions.

    This blot was produced using a 4-12% Bis-Tris gel under the MOPS buffer system. The gel was run at 200V for 60 minutes before being transferred onto a nitrocellulose membrane at 30V for 70 minutes. The membrane was blocked for an hour before being incubated with anti-MMP9 antibody [EP1254] (ab76003; 5 microgram per mL) at 4°C overnight. Antibody binding was detected using infrared labelled goat anti-rabbit (green) antibody (diluted 1:20000) for 1 hour at room temperature before imaging.

References

This product has been referenced in:
  • Annaházi A  et al. A pilot study on faecal MMP-9: a new noninvasive diagnostic marker of colorectal cancer. Br J Cancer 114:787-92 (2016). Read more (PubMed: 26908323) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157344.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up