Overview

Description

  • Nature
    Native
  • Source
    Native
  • Amino Acid Sequence
    • Accession
    • Species
      Rabbit
    • Sequence
      EAHKSEIAHRFNDVGEEHFIGLVLITFSQYLQKCPYEEHAKLVKEVTDLA KACVADESAANCDKSLHDIFGDKICALPSLRDTYGDVADCCEKKEPERNE CFLHHKDDKPDLPPFARPEADVLCKAFHDDEKAFFGHYLYEVARRHPYFY APELLYYAQKYKAILTECCEAADKGACLTPKLDALEGKSLISAAQERLRC ASIQKFGDRAYKAWALVRLSQRFPKADFTDISKIVTDLTKVHKECCHGDL LECADDRADLAKYMCEHQETISSHLKECCDKPILEKAHCIYGLHNDETPA GLPAVAEEFVEDKDVCKNYEEAKDLFLGKFLYEYSRRHPDYSVVLLLRLG KAYEATLKKCCATDDPHACYAKVLDEFQPLVDEPKNLVKQNCELYEQLGD YNFQNALLVRYTKKVPQVSTPTLVEISRSLGKVGSKCCKHPEAERLPCVE DYLSVVLNRLCVLHEKTPVSEKVTKCCSESLVDRRPCFSALGPDETYVPK EFNAETFTFHADICTLPETERKIKKQTALVELVKHKPHATNDQLKTVVGE FTALLDKCCSAEDKEACFAVEGPKLVESSKATLG
    • Molecular weight
      66 kDa
    • Amino acids
      25 to 608
    • Additional sequence information
      Prepared from rabbit plasma.

Specifications

Our Abpromise guarantee covers the use of ab188055 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .
    ab188055 is prepared by proprietary fractionation methods.
  • Form
    Lyophilised
  • Additional notes

    Extinction Coefficient: 0.67.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    Salt free.

  • Reconstitution
    Add deionized water or buffer to original or desired volume, aliquot and freeze unused portion. (50 ml before lyophilisation).

General Info

  • Alternative names
    • alb
    • ALBU_HUMAN
    • Albumin (32 AA)
    • Albumin (AA 34)
    • cell growth inhibiting protein 42
    • DKFZp779N1935
    • GIG20
    • GIG42
    • growth-inhibiting protein 20
    • OTTHUMP00000220436
    • OTTHUMP00000220438
    • OTTHUMP00000220439
    • PRO0883
    • PRO0903
    • PRO1341
    • PRO1708
    • PRO2044
    • PRO2619
    • PRO2675
    • Serum albumin
    • UNQ696/PRO1341
    see all
  • Function
    Serum albumin, the main protein of plasma, has a good binding capacity for water, Ca(2+), Na(+), K(+), fatty acids, hormones, bilirubin and drugs. Its main function is the regulation of the colloidal osmotic pressure of blood. Major zinc transporter in plasma, typically binds about 80% of all plasma zinc.
  • Tissue specificity
    Plasma.
  • Involvement in disease
    Defects in ALB are a cause of familial dysalbuminemic hyperthyroxinemia (FDH) [MIM:103600]. FDH is a form of euthyroid hyperthyroxinemia that is due to increased affinity of ALB for T(4). It is the most common cause of inherited euthyroid hyperthyroxinemia in Caucasian population.
  • Sequence similarities
    Belongs to the ALB/AFP/VDB family.
    Contains 3 albumin domains.
  • Post-translational
    modifications
    Kenitra variant is partially O-glycosylated at Thr-620. It has two new disulfide bonds Cys-600 to Cys-602 and Cys-601 to Cys-606.
    Glycated in diabetic patients.
    Phosphorylation sites are present in the extracelllular medium.
    Acetylated on Lys-223 by acetylsalicylic acid.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab188055 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188055.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up