Overview

  • Product name
  • Description
    Rabbit polyclonal to NCOA4
  • Tested applications
    Suitable for: ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NCOA4 aa 524-613.
    Sequence:

    KSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSP LQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQ


    Database link: Q13772

  • Positive control
    • ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222071 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function
    Enhances the androgen receptor transcriptional activity in prostate cancer cells. Ligand-independent coactivator of the peroxisome proliferator-activated receptor (PPAR) gamma.
  • Tissue specificity
    Widely expressed. Also detected in adipose tissues and in different cell lines. Isoform Beta is only expressed in testis.
  • Involvement in disease
    Defects in NCOA4 are a cause of thyroid papillary carcinoma (TPC) [MIM:188550]. TPC is a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue. Papillary carcinomas are malignant neoplasm characterized by the formation of numerous, irregular, finger-like projections of fibrous stroma that is covered with a surface layer of neoplastic epithelial cells. Note=A chromosomal aberration involving NCOA4 is found in thyroid papillary carcinomas. Inversion inv(10)(q11.2;q11.2) generates the RET/NCOA4 (PTC3) oncogene that has been found in sporadic and radiation-associated post-Chernobyl thyroid papillary carcinomas.
  • Information by UniProt
  • Database links
  • Alternative names
    • 70 kDa androgen receptor activator antibody
    • 70 kDa androgen receptor coactivator antibody
    • 70 kDa AR activator antibody
    • 70 kDa AR-activator antibody
    • Androgen receptor coactivator 70 kD antibody
    • Androgen receptor coactivator 70 kDa protein antibody
    • Androgen receptor-associated protein of 70 kDa antibody
    • ARA 70 antibody
    • ARA70 antibody
    • DKFZp762E1112 antibody
    • ELE 1 antibody
    • ELE1 antibody
    • ELE1/ret TK antibody
    • NCOA 4 antibody
    • NCoA-4 antibody
    • NCOA4 antibody
    • NCOA4_HUMAN antibody
    • Nuclear receptor coactivator 4 antibody
    • Papillary thyroid carcinoma 3 antibody
    • PTC 3 antibody
    • PTC3 antibody
    • RET activating gene ELE1 antibody
    • Ret activating protein ELE1 antibody
    • Ret-activating protein ELE1 antibody
    • RFG antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for NCOA4 (green) using ab222071 at 4 µg/ml in ICC/IF.

References

ab222071 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222071.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up