Overview

  • Product nameAnti-NCS1 antibody
    See all NCS1 primary antibodies
  • Description
    Rabbit polyclonal to NCS1
  • Tested applicationsSuitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to internal sequence amino acids 141-190 (

    EENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV

    ) of Human NCS1 (NP_055101).

  • Positive control
    • Human fetal thymus lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab94662 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 10 µg/ml.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 22 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionNeuronal calcium sensor, regulator of G protein-coupled receptor phosphorylation in a calcium dependent manner. Directly regulates GRK1 (RHOK), but not GRK2 to GRK5. Can substitute for calmodulin (By similarity). Stimulates PI4KB kinase activity (By similarity). Involved in long-term synaptic plasticity through its interaction with PICK1 (By similarity). May also play a role in neuron differentiation through inhibition of the activity of N-type voltage-gated calcium channel.
  • Sequence similaritiesBelongs to the recoverin family.
    Contains 4 EF-hand domains.
  • Cellular localizationGolgi apparatus > Golgi stack membrane. Cell junction > synapse > postsynaptic cell membrane > postsynaptic density. Cytoplasm > perinuclear region. Cell membrane. Associated with Golgi stacks. Post-synaptic densities of dendrites, and in the pre-synaptic nerve terminal at neuromuscular junctions.
  • Information by UniProt
  • Database links
  • Alternative names
    • 9430075O15Rik antibody
    • A730032G13Rik antibody
    • AI836659 antibody
    • DKFZp761L1223 antibody
    • FLUP antibody
    • FREQ antibody
    • Frequenin antibody
    • Frequenin homolog (Drosophila) antibody
    • Frequenin homolog antibody
    • Frequenin like protein antibody
    • Frequenin, Drosophila, homolog of antibody
    • Frequenin-like protein antibody
    • Frequenin-like ubiquitous protein antibody
    • Mfreq antibody
    • NCS 1 antibody
    • NCS-1 antibody
    • ncs1 antibody
    • NCS1_HUMAN antibody
    • Neuronal calcium sensor 1 antibody
    • Neuronal Calicum Sensor 1 antibody
    see all

Anti-NCS1 antibody images

  • Anti-NCS1 antibody (ab94662) at 1 µg/ml + Human fetal thymus lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 22 kDa
    Gel concentration: 12%
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human small intestine, myenteric plexus tissue labelling NCS1 with ab94662 at 5-10µg/ml.

References for Anti-NCS1 antibody (ab94662)

ab94662 has not yet been referenced specifically in any publications.

Product Wall

Application Western blot
Loading amount 30 µg
Gel Running Conditions Non-reduced Denaturing (10%)
Sample Mouse Tissue lysate - whole (brain, spinal cord)
Specification brain, spinal cord
Blocking step Milk as blocking agent for 1 hour(s) and 30 minute(s) · Concentration: 6% · Temperature: RT°C
Username

Abcam user community

Verified customer

Submitted Oct 18 2013

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"