Overview

  • Product name
    Anti-NDUFA2 antibody (FITC)
    See all NDUFA2 primary antibodies
  • Description
    Rabbit polyclonal to NDUFA2 (FITC)
  • Host species
    Rabbit
  • Conjugation
    FITC. Ex: 493nm, Em: 528nm
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Cynomolgus monkey, Gorilla, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human NDUFA2 aa 4-99.
    Sequence:

    AAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPI LIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA


    Database link: O43678

  • Positive control
    • Human kidney tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab193190 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100.

Target

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human kidney tissue labeling NDUFA2 with ab193190 at 1/100 dilution

References

ab193190 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193190.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up