Overview

  • Product name
  • Description
    Rabbit polyclonal to NDUFA9
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human NDUFA9 aa 153-228.
    Sequence:

    AQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVK PSDIFGREDRFLNSFASMHRFGPIPL


    Database link: Q16795

  • Positive control
    • ICC/IF: RH-30 cells. WB: RT4 and U-251 MG cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab221940 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 43 kDa.

Target

  • Function
    Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Sequence similarities
    Belongs to the complex I NDUFA9 subunit family.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt
  • Database links
  • Alternative names
    • CI-39kD antibody
    • Complex I subunit NDUFA9 antibody
    • Complex I-39kD antibody
    • mitochondrial antibody
    • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 antibody
    • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 mitochondrial antibody
    • NADH Ubiquinone Oxidoreductase 1 alpha subcomplex 9 antibody
    • NADH-ubiquinone oxidoreductase 39 kDa subunit antibody
    • NDUA9_HUMAN antibody
    • NDUFA9 antibody
    see all

Images

  • All lanes : Anti-NDUFA9 antibody (ab221940) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) cell lysate

    Predicted band size: 43 kDa

  • PFA-fixed, Triton X-100 permeabilized RH-30 cells stained for NDUFA9 (green) using ab221940 at 4 µg/ml in ICC/IF.

References

ab221940 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221940.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up