Overview

  • Product nameAnti-NDUFS3 antibody
    See all NDUFS3 primary antibodies
  • Description
    Rabbit polyclonal to NDUFS3
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 215 - 264 (EVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDA K) of Human NDUFS3 (NP_004542).

  • Positive control
    • Placenta

Associated products

Applications

Our Abpromise guarantee covers the use of ab97938 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 30 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionCore subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Sequence similaritiesBelongs to the complex I 30 kDa subunit family.
  • Cellular localizationMitochondrion inner membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CI 30 antibody
    • CI 30KD antibody
    • CI-30kD antibody
    • Complex I 30KD antibody
    • Complex I 30kDa subunit antibody
    • COMPLEX I, MITOCHONDRIAL RESPIRATORY CHAIN, 30-KD SUBUNIT antibody
    • Complex I-30kD antibody
    • mitochondrial antibody
    • NADH coenzyme Q reductase antibody
    • NADH dehydrogenase (ubiquinone) Fe S protein 3 30kDa antibody
    • NADH dehydrogenase [ubiquinone] iron sulfur protein 3 mitochondrial antibody
    • NADH dehydrogenase [ubiquinone] iron-sulfur protein 3 antibody
    • NADH dehydrogenase ubiquinone 30 kDa subunit antibody
    • NADH-ubiquinone oxidoreductase 30 kDa subunit antibody
    • NADH-Ubiquinone Oxidoreductase Fe-S Protein 3 antibody
    • NDUFS3 antibody
    • NDUS3_HUMAN antibody
    see all

Anti-NDUFS3 antibody images

  • Anti-NDUFS3 antibody (ab97938) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human placenta lysate at 10 µg

    Secondary
    HPR-conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 30 kDa

References for Anti-NDUFS3 antibody (ab97938)

ab97938 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab97938.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"