Overview

  • Product name
  • Description
    Rabbit polyclonal to NDUFS5
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human NDUFS5 aa 1-106.
    Sequence:

    MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYT RAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIG KGEPRP


    Database link: O43920

  • Positive control
    • Mouse liver lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab188510 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 13 kDa.

Target

  • Function
    Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Sequence similarities
    Belongs to the complex I NDUFS5 subunit family.
  • Domain
    Contains two C-X9-C motifs that are predicted to form a helix-coil-helix structure, permitting the formation of intramolecular disulfide bonds.
  • Cellular localization
    Mitochondrion. Mitochondrion inner membrane. Mitochondrion intermembrane space.
  • Information by UniProt
  • Database links
  • Alternative names
    • CI 15k antibody
    • CI-15 kDa antibody
    • CI15K antibody
    • Complex I-15 kDa antibody
    • NADH dehydrogenase (ubiquinone) Fe S protein 5, 15kDa (NADH coenzyme Q reductase) antibody
    • NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 antibody
    • NADH-ubiquinone oxidoreductase 15 kDa subunit antibody
    • NADH:ubiquinone oxidoreductase 15 kDa IP subunit antibody
    • NDUFS5 antibody
    • NDUS5_HUMAN antibody
    see all

Images

  • Anti-NDUFS5 antibody (ab188510) at 1/500 dilution + Mouse liver tissue lysate

    Predicted band size : 13 kDa

References

ab188510 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188510.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up