Overview

  • Product name
  • Description
    Rabbit polyclonal to NDUFV3
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human NDUFV3 aa 423-472 (C terminal).
    Sequence:

    PAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPR


    Database link: NP_066553

  • Positive control
    • HT1080 cell lysate

Applications

Our Abpromise guarantee covers the use of ab104983 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml.

Isoform 2 has predicted band 51kDa. Isoform 1 has a Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Sequence similarities
    Belongs to the complex I NDUFV3 subunit family.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CI-10k antibody
    • CI-9kD antibody
    • complex I 10kDa subunit antibody
    • complex I, mitochondrial respiratory chain, 10-kD subunit antibody
    • Complex I-9kD antibody
    • mitochondrial NADH oxidoreductase-like protein antibody
    • NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial antibody
    • NADH ubiquinone oxidoreductase 9 kD subunit antibody
    • NADH-ubiquinone oxidoreductase 9 kDa subunit antibody
    • NADH-ubiquinone oxidoreductase flavoprotein 3, 10kD antibody
    • NDUFV3 antibody
    • NDUV3_HUMAN antibody
    • Renal carcinoma antigen NY-REN-4 antibody
    see all

Images

  • Anti-NDUFV3 antibody (ab104983) at 1 µg/ml + Human Lymphoid Cell Line
  • Anti-NDUFV3 antibody (ab104983) at 1 µg/ml + HT1080 cell lysate at 10 µgIsoform 2 has a predicted band of 51kDa. 10-20% SDS-PAGE

References

ab104983 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104983.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up