Overview

  • Product nameAnti-NDUFV3 antibody
    See all NDUFV3 primary antibodies
  • Description
    Rabbit polyclonal to NDUFV3
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human NDUFV3 aa 423-472 (C terminal).
    Sequence:

    PAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPR


    Database link: NP_066553

  • Positive control
    • HT1080 cell lysate

Applications

Our Abpromise guarantee covers the use of ab104983 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml.

Isoform 2 has predicted band 51kDa. Isoform 1 has a Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionAccessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
  • Sequence similaritiesBelongs to the complex I NDUFV3 subunit family.
  • Cellular localizationMitochondrion inner membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CI-10k antibody
    • CI-9kD antibody
    • complex I 10kDa subunit antibody
    • complex I, mitochondrial respiratory chain, 10-kD subunit antibody
    • Complex I-9kD antibody
    • mitochondrial NADH oxidoreductase-like protein antibody
    • NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial antibody
    • NADH ubiquinone oxidoreductase 9 kD subunit antibody
    • NADH-ubiquinone oxidoreductase 9 kDa subunit antibody
    • NADH-ubiquinone oxidoreductase flavoprotein 3, 10kD antibody
    • NDUFV3 antibody
    • NDUV3_HUMAN antibody
    • Renal carcinoma antigen NY-REN-4 antibody
    see all

Anti-NDUFV3 antibody images

  • Anti-NDUFV3 antibody (ab104983) at 1 µg/ml + Human Lymphoid Cell Line
  • Anti-NDUFV3 antibody (ab104983) at 1 µg/ml + HT1080 cell lysate at 10 µgIsoform 2 has a predicted band of 51kDa. 10-20% SDS-PAGE

References for Anti-NDUFV3 antibody (ab104983)

ab104983 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104983.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"