Overview

  • Product name
  • Description
    Rabbit polyclonal to NEDD1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 2-51 (

    QENLRFASSGDDIKIWDASSMTLVDKFNPHTSPHGISSICWSSNNNFLVT

    ) of Human NEDD1 (NP_690869)

  • Positive control
    • Human fetal spleen lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab89738 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 72 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-NEDD1 antibody images

  • Anti-NEDD1 antibody (ab89738) at 1 µg/ml + Human fetal spleen lysate at 10 µg

    Secondary
    HRP anti rabbit IgG at 1/50000 dilution

    Predicted band size : 72 kDa
    Observed band size : 72 kDa
    Additional bands at : 45 kDa,58 kDa. We are unsure as to the identity of these extra bands.

References for Anti-NEDD1 antibody (ab89738)

ab89738 has not yet been referenced specifically in any publications.

Product Wall

Abcam has not validated the combination of species/application used in this Abreview.
Application
Immunocytochemistry/ Immunofluorescence
Sample
Xenopus laevis Cell (Spindles in X. laevis cytoplasmic egg extract)
Specification
Spindles in X. laevis cytoplasmic egg extract
Fixative
Methanol
Permeabilization
No
Blocking step
BSA as blocking agent for 30 minute(s) · Concentration: 3% · Temperature: 25°C
Username

Abcam user community

Verified customer

Submitted Oct 09 2012

Abcam has not validated the combination of species/application used in this Abreview.
Application
Western blot
Sample
Xenopus laevis Cell lysate - other (Xenopus laevis cytoplasmic egg extract)
Loading amount
50 µg
Specification
Xenopus laevis cytoplasmic egg extract
Gel Running Conditions
Reduced Denaturing (10%)
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
Username

Abcam user community

Verified customer

Submitted Oct 05 2012

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up