Overview

  • Product nameAnti-Nephronophthisis antibody
    See all Nephronophthisis primary antibodies
  • Description
    Rabbit polyclonal to Nephronophthisis
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 467-516 (

    ILFELGISYIRNSTGERGELSCGWVFLKLFDASGVPIPAKTYELFLNGGT

    ) of Human Nephronophthisis (NP_000263).

  • Positive control
    • Human fetal heart lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab90829 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 83 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceJuvenile nephronophthsis, an autosomal recessive cystic kidney disease, is the primary cause for chronic renal failure in children. The gene for nephronophthsis type 1 (NPHP1) has recently been identified. Nephronophthisis together with Cas it may play a role in the control of epithelial cell polarity. Seems to help to recruit protein tyrosine kinase 2 beta (PTK2B) to cell matrix adhesions, thereby initiating phosphorylation of PTK2B and PTK2B-dependent signaling . NPHP1 expression has been studied in mouse and human systems. Expression in the human adult is widespread but relatively weak. In contrast, expression in adult mouse is strong and localized to the testis. In situ hybridization to whole mouse embryo demonstrates widespread and consistently strong expression throughout all developmental stages. 4 isoforms exist, produced by alternative splicing.
  • Cellular localizationCell junction, adherens junction. Cell projection, cilium. Cytoplasm, cytoskeleton, cilium axoneme. Cell junction, tight junction.
  • Database links
  • Alternative names
    • JBTS4 antibody
    • Juvenile nephronophthisis 1 protein antibody
    • Nephrocystin 1 antibody
    • nephronophthisis 1 (juvenile) antibody
    • Nephronophthisis antibody
    • NPH1 antibody
    • NPHP1 antibody
    • SLSN1 antibody
    see all

Anti-Nephronophthisis antibody images

  • Anti-Nephronophthisis antibody (ab90829) at 1 µg/ml + Human fetal heart lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 83 kDa

References for Anti-Nephronophthisis antibody (ab90829)

ab90829 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90829.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"