Overview

  • Product name
    Anti-Neprilysin-2 antibody
    See all Neprilysin-2 primary antibodies
  • Description
    Mouse polyclonal to Neprilysin-2
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Neprilysin-2 aa 1-779.
    Sequence:

    MGKSEGPVGMVESAGRAGQKRPGFLEGGLLLLLLLVTAALVALGVLYADR RGKQLPRLASRLCFLQEERTFVKRKPRGIPEAQEVSEVCTTPGCVIAAAR ILQNMDPTTEPCDDFYQFACGGWLRRHVIPETNSRYSIFDVLRDELEVIL KAVLENSTAKDRPAVEKARTLYRSCMNQSVIEKRGSQPLLDILEVVGGWP VAMDRWNETVGLEWELERQLALMNSQFNRRVLIDLFIWNDDQNSSRHIIY IDQPTLGMPSREYYFNGGSNRKVREAYLQFMVSVATLLREDANLPRDSCL VQEDMVQVLELETQLAKATVPQEERHDVIALYHRMGLEELQSQFGLKGFN WTLFIQTVLSSVKIKLLPDEEVVVYGIPYLQNLENIIDTYSARTIQNYLV WRLVLDRIGSLSQRFKDTRVNYRKALFGTMVEEVRWRECVGYVNSNMENA VGSLYVREAFPGDSKSMVRELIDKVRTVFVETLDELGWIDEESKKKAQEK AMSIREQIGHPDYILEETNRRLDEEYSNLNFSEDLYFENSLQNLKVGAQR SLRKLREKVDPNLWIIGAAVVNAFYSPNRNQIVFPAGILQPPFFSKEQPQ ALNFGGIGMVIGHEITHGFDDNGRNFDKNGNMMDWWSNFSTQHFREQSEC MIYQYGNYSWDLADEQNVNGFNTLGENIADNGGVRQAYKAYLKWMAEGGK DQQLPGLDLTHEQLFFINYAQVWCGSYRPEFAIQSIKTDVHSPLKYRVLG SLQNLAAFADTFHCARGTPMHPKERCRVW


    Database link: AAI01031.1

  • Positive control
    • WB: Neprilysin-2 transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab168182 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 89 kDa.

Target

  • Function
    Metalloprotease involved in sperm function, possibly by modulating the processes of fertilization and early embryonic development. Degrades a broad variety of small peptides with a preference for peptides shorter than 3 kDa containing neutral bulky aliphatic or aromatic amino acid residues. Shares the same substrate specificity with MME and cleaves peptides at the same amide bond.
  • Tissue specificity
    Predominantly expressed in testis. Weakly expressed in brain, kidney and heart.
  • Sequence similarities
    Belongs to the peptidase M13 family.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Membrane. Secreted. A secreted form produced by proteollytic cleavage also exists.
  • Information by UniProt
  • Database links
  • Alternative names
    • Mel transforming oncogene like 1 antibody
    • Membrane metallo endopeptidase like 1 antibody
    • Membrane metallo endopeptidase like 2 antibody
    • Membrane metallo-endopeptidase-like 1 antibody
    • Membrane metallo-endopeptidase-like 2 antibody
    • MMEL1 antibody
    • MMEL1_HUMAN antibody
    • NEP2 antibody
    • NEP2(m) antibody
    • NEP2(s) antibody
    • NEPII antibody
    • Neprilysin 2 antibody
    • Neprilysin II antibody
    • Neprilysin Like 1 antibody
    • Neprilysin-2 antibody
    • Neprilysin-2 secreted antibody
    • Neprilysin-like Protease beta antibody
    • Neprilysin-like Protease gamma antibody
    • NL1 antibody
    • NL2 antibody
    • SEP antibody
    • soluble form antibody
    • Soluble secreted endopeptidase antibody
    see all

Images

  • All lanes : Anti-Neprilysin-2 antibody (ab168182) at 1/500 dilution

    Lane 1 : Neprilysin-2 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    Goat anti-Mouse IgG HRP at 1/2500 dilution

    Predicted band size : 89 kDa

References

ab168182 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168182.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up