Anti-Neprilysin-2 antibody (ab81688)

Overview

  • Product name
    Anti-Neprilysin-2 antibody
    See all Neprilysin-2 primary antibodies
  • Description
    Rabbit polyclonal to Neprilysin-2
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human Neprilysin-2 aa 371-420 (internal sequence).
    Sequence:

    EVVVYGIPYLQNLENIIDTYSARTIQNYLVWRLVLDRIGSLSQRFKDTRV


    Database link: NP_258428

  • Positive control
    • Fetal liver lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab81688 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 89 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay, 1:312500.

Target

  • Function
    Metalloprotease involved in sperm function, possibly by modulating the processes of fertilization and early embryonic development. Degrades a broad variety of small peptides with a preference for peptides shorter than 3 kDa containing neutral bulky aliphatic or aromatic amino acid residues. Shares the same substrate specificity with MME and cleaves peptides at the same amide bond.
  • Tissue specificity
    Predominantly expressed in testis. Weakly expressed in brain, kidney and heart.
  • Sequence similarities
    Belongs to the peptidase M13 family.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Membrane. Secreted. A secreted form produced by proteollytic cleavage also exists.
  • Information by UniProt
  • Database links
  • Alternative names
    • Mel transforming oncogene like 1 antibody
    • Membrane metallo endopeptidase like 1 antibody
    • Membrane metallo endopeptidase like 2 antibody
    • Membrane metallo-endopeptidase-like 1 antibody
    • Membrane metallo-endopeptidase-like 2 antibody
    • MMEL1 antibody
    • MMEL1_HUMAN antibody
    • NEP2 antibody
    • NEP2(m) antibody
    • NEP2(s) antibody
    • NEPII antibody
    • Neprilysin 2 antibody
    • Neprilysin II antibody
    • Neprilysin Like 1 antibody
    • Neprilysin-2 antibody
    • Neprilysin-2 secreted antibody
    • Neprilysin-like Protease beta antibody
    • Neprilysin-like Protease gamma antibody
    • NL1 antibody
    • NL2 antibody
    • SEP antibody
    • soluble form antibody
    • Soluble secreted endopeptidase antibody
    see all

Anti-Neprilysin-2 antibody images

  • Anti-Neprilysin-2 antibody (ab81688) at 1 µg/ml (in 5% skim milk / PBS buffer) + fetal liver lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 89 kDa
    Observed band size : 89 kDa
    12% gel

References for Anti-Neprilysin-2 antibody (ab81688)

ab81688 has not yet been referenced specifically in any publications.

Product Wall

Application
Western blot
Sample
Rat Tissue lysate - whole (Testis and Brain)
Gel Running Conditions
Reduced Denaturing (10%)
Loading amount
100 µg
Specification
Testis and Brain
Blocking step
Milk as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 21°C
Username

Renato Watanabe de Oliveira

Verified customer

Submitted Oct 29 2013

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up