Overview

  • Product nameAnti-NET1 antibody [2633C5a]
    See all NET1 primary antibodies
  • Description
    Mouse monoclonal [2633C5a] to NET1
  • Tested applicationsSuitable for: WB, Dot blotmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NET1 aa 474-588.
    Sequence:

    SPAQSHTLQANDVFHKQQWFNCIRAAIAPFQSAGSPPELQGLPELHEECE GNHPSARKLTAQRRASTVSSVTQVEVDENAYRCGSGMQMAEDSKSLKTHQ TQPGIRRARDKALSG

Properties

Applications

Our Abpromise guarantee covers the use of ab51351 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent dilution. Predicted molecular weight: 68 kDa.
Dot blot Use at an assay dependent dilution.

Target

  • FunctionActs as guanine nucleotide exchange factor (GEF) for RhoA GTPase. May be involved in activation of the SAPK/JNK pathway Stimulates genotoxic stress-induced RHOB activity in breast cancer cells leading to their cell death.
  • Tissue specificityWidely expressed.
  • Sequence similaritiesContains 1 DH (DBL-homology) domain.
    Contains 1 PH domain.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • ARHG8_HUMAN antibody
    • ARHGEF8 antibody
    • GLYT2 antibody
    • Guanine nucleotide regulatory protein oncogene antibody
    • MGC114559 antibody
    • MGC127767 antibody
    • MGC53602 antibody
    • mNET1 antibody
    • Net1 antibody
    • NET1A antibody
    • Neuroepithelial cell transforming gene 1 antibody
    • Neuroepithelial cell-transforming gene 1 protein antibody
    • p65 Net1 proto oncogene antibody
    • Proto-oncogene p65 Net1 antibody
    • Rho guanine nucleotide exchange factor 8 antibody
    • Rho guanine nucleotide exchange factor GEF 8 antibody
    see all

Anti-NET1 antibody [2633C5a] images

References for Anti-NET1 antibody [2633C5a] (ab51351)

ab51351 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab51351.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"