Overview

  • Product name
    Anti-NET1 antibody [2633C5a]
    See all NET1 primary antibodies
  • Description
    Mouse monoclonal [2633C5a] to NET1
  • Tested applications
    Suitable for: WB, Dot blotmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human NET1 aa 474-588.
    Sequence:

    SPAQSHTLQANDVFHKQQWFNCIRAAIAPFQSAGSPPELQGLPELHEECE GNHPSARKLTAQRRASTVSSVTQVEVDENAYRCGSGMQMAEDSKSLKTHQ TQPGIRRARDKALSG

Properties

Applications

Our Abpromise guarantee covers the use of ab51351 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent dilution. Predicted molecular weight: 68 kDa.
Dot blot Use at an assay dependent dilution.

Target

  • Function
    Acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase. May be involved in activation of the SAPK/JNK pathway Stimulates genotoxic stress-induced RHOB activity in breast cancer cells leading to their cell death.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Contains 1 DH (DBL-homology) domain.
    Contains 1 PH domain.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • ARHG8_HUMAN antibody
    • ARHGEF8 antibody
    • GLYT2 antibody
    • Guanine nucleotide regulatory protein oncogene antibody
    • MGC114559 antibody
    • MGC127767 antibody
    • MGC53602 antibody
    • mNET1 antibody
    • Net1 antibody
    • NET1A antibody
    • Neuroepithelial cell transforming gene 1 antibody
    • Neuroepithelial cell-transforming gene 1 protein antibody
    • p65 Net1 proto oncogene antibody
    • Proto-oncogene p65 Net1 antibody
    • Rho guanine nucleotide exchange factor 8 antibody
    • Rho guanine nucleotide exchange factor GEF 8 antibody
    see all

Images

References

ab51351 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab51351.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up