
  • Product nameAnti-NET1 antibody
    See all NET1 primary antibodies
  • Description
    Rabbit polyclonal to NET1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Saccharomyces cerevisiae
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 287-336 (AILIIQGVLSDINLKKGESECQYYIDKLEYLDEKQRDPRIEASKVLLCH G) of Human NET1 (NP_005854).

  • Positive control
    • Jurkat cell lysate



Our Abpromise guarantee covers the use of ab84615 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 62 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • FunctionActs as guanine nucleotide exchange factor (GEF) for RhoA GTPase. May be involved in activation of the SAPK/JNK pathway Stimulates genotoxic stress-induced RHOB activity in breast cancer cells leading to their cell death.
  • Tissue specificityWidely expressed.
  • Sequence similaritiesContains 1 DH (DBL-homology) domain.
    Contains 1 PH domain.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • ARHG8_HUMAN antibody
    • ARHGEF8 antibody
    • GLYT2 antibody
    • Guanine nucleotide regulatory protein oncogene antibody
    • MGC114559 antibody
    • MGC127767 antibody
    • MGC53602 antibody
    • mNET1 antibody
    • Net1 antibody
    • NET1A antibody
    • Neuroepithelial cell transforming gene 1 antibody
    • Neuroepithelial cell-transforming gene 1 protein antibody
    • p65 Net1 proto oncogene antibody
    • Proto-oncogene p65 Net1 antibody
    • Rho guanine nucleotide exchange factor 8 antibody
    • Rho guanine nucleotide exchange factor GEF 8 antibody
    see all

Anti-NET1 antibody images

  • Anti-NET1 antibody (ab84615) at 1 µg/ml + Jurkat cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 62 kDa
    Observed band size : 65 kDa (why is the actual band size different from the predicted?)
    Additional bands at : >90 kDa. We are unsure as to the identity of these extra bands.

References for Anti-NET1 antibody (ab84615)

ab84615 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab84615.
Please use the links above to contact us or submit feedback about this product.