Overview

  • Product name
  • Description
    Rabbit polyclonal to Neurexin 1
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human Neurexin 1 aa 40-90 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    WTRFPKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRL Q


    Database link: Q9ULB1

  • Positive control
    • Rat brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab214191 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function
    Cell surface protein involved in cell-cell-interactions, exocytosis of secretory granules and regulation of signal transmission. Function is isoform-specific. Alpha-type isoforms have a long N-terminus with six laminin G-like domains and play an important role in synaptic signal transmission. Alpha-type isoforms play a role in the regulation of calcium channel activity and Ca(2+)-triggered neurotransmitter release at synapses and at neuromuscular junctions. They play an important role in Ca(2+)-triggered exocytosis of secretory granules in pituitary gland. They may effect their functions at synapses and in endocrine cells via their interactions with proteins from the exocytotic machinery. Likewise, alpha-type isoforms play a role in regulating the activity of postsynaptic NMDA receptors, a subtype of glutamate-gated ion channels. Both alpha-type and beta-type isoforms may play a role in the formation or maintenance of synaptic junctions via their calcium-dependent interactions (via the extracellular domains) with neuroligin family members, CBLN1 or CBLN2. In vitro, triggers the de novo formation of presynaptic structures. May be involved in specification of excitatory synapses. Alpha-type isoforms were first identified as receptors for alpha-latrotoxin from spider venom.
  • Tissue specificity
    Brain.
  • Sequence similarities
    Belongs to the neurexin family.
    Contains 3 EGF-like domains.
    Contains 6 laminin G-like domains.
  • Post-translational
    modifications
    N-glycosylated.
    O-glycosylated.
  • Cellular localization
    Cell membrane. Cell junction, synapse. Localized on the pre-synaptic membrane.
  • Information by UniProt
  • Database links
  • Form
    The neurexin genes use alternate promoters, splice sites and exons to encode potentially hundreds or thousands of mRNA transcripts.
  • Alternative names
    • DKFZp313P2036 antibody
    • FLJ35941 antibody
    • Hs.22998 antibody
    • KIAA0578 antibody
    • Neurexin 1 alpha antibody
    • Neurexin 1 beta antibody
    • Neurexin I-alpha antibody
    • Neurexin-1 antibody
    • Neurexin-1-alpha antibody
    • NRX1A_HUMAN antibody
    • NRXN1 antibody
    • PTHSL2 antibody
    • SCZD17 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling Neurexin 1 with ab214191 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

References

ab214191 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214191.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up