Overview

  • Product name
  • Description
    Rabbit polyclonal to NEURL2
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 143-192 (

    VEPYLRIEQFRIPRDRLVGRSRPGLYSHLLDQLYELNVLPPTARRSRLGV

    ) of Human NEURL2 (NP_542787).

  • Positive control
    • Human Placenta Lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab99125 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 32 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Plays an important role in the process of myofiber differentiation and maturation. Probable substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex, which mediates the ubiquitination of proteins. Probably contributes to catalysis through recognition and positioning of the substrate and the ubiquitin-conjugating enzyme. During myogenesis, controls the ubiquitination and degradation of the specific pool of CTNNB1/beta-catenin located at the sarcolemma.
  • Tissue specificity
    Expressed specifically in skeletal and cardiac muscles.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 NHR (neuralized homology repeat) domain.
    Contains 1 SOCS box domain.
  • Domain
    The SOCS domain mediates the interaction with TCEB1 and TCEB2, while the NHR domain may be involved in ubiquitination substrate binding.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • NEUL2_HUMAN antibody
    • Neuralized like protein 2 antibody
    • Neuralized-like protein 2 antibody
    • NEURL2 antibody

Anti-NEURL2 antibody images

  • Anti-NEURL2 antibody (ab99125) at 1 µg/ml + Human Placenta Lysate at 10 µg

    Predicted band size : 32 kDa

References for Anti-NEURL2 antibody (ab99125)

ab99125 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99125.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up