Overview

  • Product nameAnti-Neurochondrin antibody
    See all Neurochondrin primary antibodies
  • Description
    Rabbit polyclonal to Neurochondrin
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 1-50 (

    MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDS

    ) of Human Neurochondrin (NP_055099).

  • Positive control
    • Human Fetal Brain Lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab98351 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 79 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceNeurochondrin is a leucine rich cytoplasmic protein, which is highly similar to a mouse protein that negatively regulates Ca/calmodulin dependent protein kinase II phosphorylation and may be essential for spatial learning processes.
  • Cellular localizationCytoplasm. Cell projection, dendrite. Note: Localizes to somatic regions of neurons.
  • Database links
  • Alternative names
    • AU042419 antibody
    • KIAA0607 antibody
    • M-Sema F-associating protein of 75 kDa antibody
    • MGC93259 antibody
    • MMS10-AE antibody
    • Ms10ae antibody
    • NCDN antibody
    • NCDN-1 antibody
    • NCDN-2 antibody
    • Neurochondrin 1 antibody
    • Norbin antibody
    • OTTHUMP00000065369 antibody
    • OTTHUMP00000065370 antibody
    • OTTHUMP00000065371 antibody
    • Sfap75 antibody
    see all

Anti-Neurochondrin antibody images

  • Anti-Neurochondrin antibody (ab98351) at 1 µg/ml + Human Fetal Brain Lysate at 10 µg

    Predicted band size : 79 kDa

References for Anti-Neurochondrin antibody (ab98351)

ab98351 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98351.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"