Overview

  • Product nameAnti-Neurogranin antibody
    See all Neurogranin primary antibodies
  • Description
    Rabbit polyclonal to Neurogranin
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 6-55 (

    ESACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGECGRKG

    ) of Rat Neurogranin (NP_077054).

  • Positive control
    • Rat brain lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab125316 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 8 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionActs as a "third messenger" substrate of protein kinase C-mediated molecular cascades during synaptic development and remodeling. Binds to calmodulin in the absence of calcium.
  • Tissue specificityIn the cerebral cortex, found in the cell bodies of neurons in layers II-VI, and in apical and basal dendrites of pyramidal neurons. Is not found in the dendrites in patients with Alzheimer disease.
  • Sequence similaritiesBelongs to the neurogranin family.
    Contains 1 collagen-like domain.
    Contains 1 IQ domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • Protein kinase C substrate RC3 antibody
    • Calmodulin binding protein antibody
    • Hng antibody
    • NEUG(55-78) antibody
    • NEUG_HUMAN antibody
    • Neurogranin (protein kinase C substrate) antibody
    • Ng antibody
    • NRGN antibody
    • Protein kinase C substrate antibody
    • RC3 antibody
    see all

Anti-Neurogranin antibody images

  • Anti-Neurogranin antibody (ab125316) at 1 µg/ml + Rat brain lysate at 10 µg

    Predicted band size : 8 kDa

References for Anti-Neurogranin antibody (ab125316)

ab125316 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab125316.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"