Overview

  • Product name
  • Description
    Rabbit polyclonal to Neurogranin
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Goat, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 6-55 (

    ESACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGECGRKG

    ) of Rat Neurogranin (NP_077054).

  • Positive control
    • Rat brain lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab125316 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 8 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Acts as a "third messenger" substrate of protein kinase C-mediated molecular cascades during synaptic development and remodeling. Binds to calmodulin in the absence of calcium.
  • Tissue specificity
    In the cerebral cortex, found in the cell bodies of neurons in layers II-VI, and in apical and basal dendrites of pyramidal neurons. Is not found in the dendrites in patients with Alzheimer disease.
  • Sequence similarities
    Belongs to the neurogranin family.
    Contains 1 collagen-like domain.
    Contains 1 IQ domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • Protein kinase C substrate RC3 antibody
    • Calmodulin binding protein antibody
    • Hng antibody
    • NEUG(55-78) antibody
    • NEUG_HUMAN antibody
    • Neurogranin (protein kinase C substrate) antibody
    • Ng antibody
    • NRGN antibody
    • Protein kinase C substrate antibody
    • RC3 antibody
    see all

Images

  • Anti-Neurogranin antibody (ab125316) at 1 µg/ml + Rat brain lysate at 10 µg

    Predicted band size : 8 kDa

References

ab125316 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab125316.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up