Overview

  • Product name
    Anti-Neuroligin 3 antibody
    See all Neuroligin 3 primary antibodies
  • Description
    Mouse polyclonal to Neuroligin 3
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Full length protein corresponding to Human Neuroligin 3 aa 1-828.
    Sequence:

    MWLRLGPPSLSLSPKPTVGRSLCLTLWFLSLALRASTQAPAPTVNTHFGK LRGARVPLPSEILGPVDQYLGVPYAAPPIGEKRFLPPEPPPYWSGIRNAT HFPPVCPQNIHTAVPEVMLPVWFTANLDIVATYIQEPNEDCLYLNVYVPT EDGSGAKKQGEDLADNDGDEDEDIRDSGAKPVMVYIHGGSYMEGTGNMID GSILASYGNVIVITLNYRVGVLGFLSTGDQAAKGNYGLLDQIQALRWVSE NIAFFGGDPRRITVFGSGIGASCVSLLTLSHHSEGLFQRAIIQSGSALSS WAVNYQPVKYTSLLADKVGCNVLDTVDMVDCLRQKSAKELVEQDIQPARY HVAFGPVIDGDVIPDDPEILMEQGEFLNYDIMLGVNQGEGLKFVEGVVDP EDGVSGTDFDYSVSNFVDNLYGYPEGKDTLRETIKFMYTDWADRDNPETR RKTLVALFTDHQWVEPSVVTADLHARYGSPTYFYAFYHHCQSLMKPAWSD AAHGDEVPYVFGVPMVGPTDLFPCNFSKNDVMLSAVVMTYWTNFAKTGDP NKPVPQDTKFIHTKANRFEEVAWSKYNPRDQLYLHIGLKPRVRDHYRATK VAFWKHLVPHLYNLHDMFHYTSTTTKVPPPDTTHSSHITRRPNGKTWSTK RPAISPAYSNENAQGSWNGDQDAGPLLVENPRDYSTELSVTIAVGASILF LNVLAFAALYYRKDKRRQEPLRQPSPQRGAWAPELGAAPEEELAALQLGP THHECEASPPHDTLRLTALPDYTLTLRRSPDDIPLMTPNTITMIPNSLVG LQTLHPYNTFAAGFNSTGLPHSHSTTRV


    Database link: AAH51715.1

  • Positive control
    • Neuroligin 3 transfected 293T cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab172798 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 92 kDa.

Target

  • Function
    Cell surface protein involved in cell-cell-interactions via its interactions with neurexin family members. Plays a role in synapse function and synaptic signal transmission, and may mediate its effects by clustering other synaptic proteins. May promote the initial formation of synapses, but is not essential for this. May also play a role in glia-glia or glia-neuron interactions in the developing peripheral nervous system.
  • Tissue specificity
    Expressed in the blood vessel walls (at protein level). Detected in throughout the brain and in spinal cord. Detected in brain, and at lower levels in pancreas islet beta cells.
  • Involvement in disease
    Autism, X-linked 1 (AUTSX1) [MIM:300425]: A complex multifactorial, pervasive developmental disorder characterized by impairments in reciprocal social interaction and communication, restricted and stereotyped patterns of interests and activities, and the presence of developmental abnormalities by 3 years of age. Most individuals with autism also manifest moderate mental retardation. Note=Disease susceptibility is associated with variations affecting the gene represented in this entry.
    X-linked Asperger syndrome 1 (ASPGX1) [MIM:300494]: Considered to be a form of childhood autism. Note=Disease susceptibility is associated with variations affecting the gene represented in this entry.
  • Sequence similarities
    Belongs to the type-B carboxylesterase/lipase family.
  • Cellular localization
    Cell membrane. Cell junction > synapse. Detected at both glutamatergic and GABAergic synapses.
  • Information by UniProt
  • Database links
  • Alternative names
    • Gliotactin homolog antibody
    • HNL3 antibody
    • Neuroligin-3 antibody
    • Nlgn3 antibody
    • NLGN3_HUMAN antibody
    see all

Images

  • All lanes : Anti-Neuroligin 3 antibody (ab172798) at 1 µg/ml

    Lane 1 : Neuroligin 3 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 92 kDa

References

ab172798 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172798.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up