Overview

  • Product name
  • Description
    Rabbit polyclonal to Neuronatin
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human Neuronatin aa 24-54. The exact sequence is proprietary. NP_859017.
    Sequence:

    YWVGFAFRNPPGTQPIARSEVFRYSLQKLAYTVSRTGRQVLGERRQRAPN


    Database link: Q16517-2

  • Positive control
    • Human fetal heart lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Constituents: 98% PBS, 2% Sucrose
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab186710 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 6 kDa.

Target

  • Function
    May participate in the maintenance of segment identity in the hindbrain and pituitary development, and maturation or maintenance of the overall structure of the nervous system. May function as a regulatory subunit of ion channels.
  • Sequence similarities
    Belongs to the neuronatin family.
  • Developmental stage
    Abundant in 18-24 week old fetal brain. Postnatally its expression decline and only minimal levels were present in adulthood.
  • Information by UniProt
  • Database links
  • Alternative names
    • Neuronatin antibody
    • NNAT antibody
    • NNAT_HUMAN antibody
    • Peg 5 antibody
    • Peg5 antibody
    see all

Images

  • Anti-Neuronatin antibody (ab186710) at 1 µg/ml + Human fetal heart lysate at 10 µg

    Predicted band size: 6 kDa

References

ab186710 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186710.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up