Neuropeptide Y (NPY) (human, rat), Endogenous neuropeptide (ab120208)
Key features and details
- Endogenous neuropeptide
- CAS Number: 90880-35-6
- Soluble in water
- Form / State: Solid
- Source: Synthetic
Overview
-
Product name
Neuropeptide Y (NPY) (human, rat), Endogenous neuropeptide -
Description
Endogenous neuropeptide -
Alternative names
- NPY (human, rat)
-
Biological description
Neuropeptide involved in cardiovascular physiology, feeding, anxiety, depression and epilepsy.
-
CAS Number
90880-35-6 -
Chemical structure
Properties
-
Molecular weight
4271.69 -
Molecular formula
C189H285N55O57S -
Sequence
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY (Modifications: C-terminal amide) -
PubChem identifier
24868177 -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in water -
Handling
This product is supplied in one (or more) pack size which is freeze dried. Therefore the contents may not be readily visible, as they can coat the bottom or walls of the vial. Please see our FAQs and information page for more details on handling.
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Synthetic
-
Research areas
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (2)
ab120208 has been referenced in 2 publications.
- Palanivel V et al. Neuroprotective Effects of Neuropeptide Y on Human Neuroblastoma SH-SY5Y Cells in Glutamate Excitotoxicity and ER Stress Conditions. Cells 11:N/A (2022). PubMed: 36429093
- Toorie AM et al. A history of opioid exposure in females increases the risk of metabolic disorders in their future male offspring. Addict Biol 26:e12856 (2021). PubMed: 31782234