Overview

  • Product name
  • Description
    Rabbit polyclonal to Neurotensin
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow, Dog
  • Immunogen

    Full length protein corresponding to Human Neurotensin aa 1-170.
    Sequence:

    MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAH VPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEA MLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKR QLYENKPRRPYILKRDSYYY


    Database link: P30990

  • Positive control
    • Neurotensin transfected 293T cell line.

Properties

Applications

Our Abpromise guarantee covers the use of ab172114 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 20 kDa.

Target

  • Function
    Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle.
  • Sequence similarities
    Belongs to the neurotensin family.
  • Cellular localization
    Secreted. Cytoplasmic vesicle > secretory vesicle. Packaged within secretory vesicles.
  • Information by UniProt
  • Database links
  • Alternative names
    • Human proneurotensin antibody
    • Large neuromedin N antibody
    • Neuromedin N preproprotein antibody
    • Neurotensin/neuromedin N antibody
    • NEUT_HUMAN antibody
    • NMN 125 antibody
    • NmN antibody
    • NmN-125 antibody
    • NN antibody
    • NT antibody
    • NT/N antibody
    • NTRH antibody
    • NTS antibody
    • NTS1 antibody
    • Pro neurotensin/neuromedin antibody
    • Proneuromedin N mRNA antibody
    • Tail peptide antibody
    see all

Images

  • All lanes : Anti-Neurotensin antibody (ab172114) at 1 µg/ml

    Lane 1 : Neurotensin transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Rabbit IgG (H&L)-HRP at 1/7500 dilution

    Developed using the ECL technique.

    Predicted band size: 20 kDa

References

ab172114 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172114.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up