Overview

  • Product nameAnti-NFAT2 antibody
    See all NFAT2 primary antibodies
  • Description
    Rabbit polyclonal to NFAT2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 755-804 (STLMPAAPGVSPKLHDLSPAAYTKGVASPGHCHLGLPQPAGEAPAVQDV P) of Human NFAT2 (NP_006153).

  • Positive control
    • NCI-H226 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab98173 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 101 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionPlays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2 or IL-4 gene transcription. Also controls gene expression in embryonic cardiac cells. Could regulate not only the activation and proliferation but also the differentiation and programmed death of T-lymphocytes as well as lymphoid and non-lymphoid cells.
  • Tissue specificityExpressed in thymus, peripheral leukocytes as T-cells and spleen. Isoforms A are preferentially expressed in effector T-cells (thymus and peripheral leukocytes) whereas isoforms B and isoforms C are preferentially expressed in naive T-cells (spleen). Isoforms B are expressed in naive T-cells after first antigen exposure and isoforms A are expressed in effector T-cells after second antigen exposure.
  • Sequence similaritiesContains 1 RHD (Rel-like) domain.
  • DomainRel Similarity Domain (RSD) allows DNA-binding and cooperative interactions with AP1 factors.
    The N-terminal transactivation domain (TAD-A) binds to and is activated by Cbp/p300. The dephosphorylated form contains two unmasked nuclear localization signals (NLS), which allow translocation of the protein to the nucleus.
    Isoforms C have a C-terminal part with an additional trans-activation domain, TAD-B, which acts as a transcriptional activator. Isoforms B have a shorter C-terminal part without complete TAD-B which acts as a transcriptional repressor.
  • Post-translational
    modifications
    Phosphorylated by NFATC-kinase; dephosphorylated by calcineurin.
  • Cellular localizationCytoplasm. Nucleus. Cytoplasmic for the phosphorylated form and nuclear after activation that is controlled by calcineurin-mediated dephosphorylation. Rapid nuclear exit of NFATC is thought to be one mechanism by which cells distinguish between sustained and transient calcium signals. The subcellular localization of NFATC plays a key role in the regulation of gene transcription.
  • Information by UniProt
  • Database links
  • Alternative names
    • cytoplasmic 1 antibody
    • MGC138448 antibody
    • NF ATc antibody
    • NF ATc1 antibody
    • NF-ATc antibody
    • NF-ATc1 antibody
    • NF-ATc1.2 antibody
    • NFAC1_HUMAN antibody
    • NFAT 2 antibody
    • NFAT transcription complex cytosolic component antibody
    • NFATC 1 antibody
    • NFATc antibody
    • NFATc1 antibody
    • Nuclear factor of activated T cells cytoplasmic 1 antibody
    • Nuclear factor of activated T cells cytoplasmic calcineurin dependent 1 antibody
    • Nuclear factor of activated T cells cytosolic component 1 antibody
    • nuclear factor of activated T-cells 'c' antibody
    • Nuclear factor of activated T-cells antibody
    see all

Anti-NFAT2 antibody images

  • Anti-NFAT2 antibody (ab98173) at 1 µg/ml (5% skim milk / PBS buffer) + NCI-H226 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 101 kDa

References for Anti-NFAT2 antibody (ab98173)

ab98173 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98173.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"