Overview

  • Product name
  • Description
    Rabbit polyclonal to NFIA
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human
  • Immunogen

    Synthetic peptide within Mouse NFIA aa 201-250 (internal sequence). The exact sequence is proprietary.
    Sequence:

    YLAYFVHAADSSQSESPSQPSEADIKDQPENGHLGFQDSFVTSGVFSVTE


    Database link: NP_001116424

  • Positive control
    • Mouse brain lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab170984 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 58 kDa.

Target

  • Function
    Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.
  • Sequence similarities
    Belongs to the CTF/NF-I family.
    Contains 1 CTF/NF-I DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • 1110047K16Rik antibody
    • 9430022M17Rik antibody
    • CCAAT Box Binding Transcription Factor antibody
    • CCAAT-box-binding transcription factor antibody
    • CTF antibody
    • FLJ39164 antibody
    • NF I/A antibody
    • NF-I/A antibody
    • NF1-A antibody
    • NFI A antibody
    • NFI L antibody
    • NFI-A antibody
    • NFIA antibody
    • NFIA_HUMAN antibody
    • Nuclear factor 1 A type antibody
    • Nuclear factor 1 A-type antibody
    • Nuclear factor 1/A antibody
    • Nuclear factor I/A antibody
    • TGGCA binding protein antibody
    • TGGCA-binding protein antibody
    see all

Images

  • Anti-NFIA antibody (ab170984) at 1 µg/ml + Mouse brain lysate at 10 µg

    Predicted band size: 58 kDa

References

ab170984 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab170984.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up