Overview

  • Product name
  • Description
    Rabbit polyclonal to NFIC
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide (human). The exact amino acid sequence is considered to be commercially sensitive but was derived from the following sequence: VRERDAEQSGSPRTGMGSDQEDSKPITLDTTDFQESFVT SGVFSVTELIQ

  • Positive control
    • HepG2 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab48948 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2.5 µg/ml. Detects a band of approximately 48 kDa (predicted molecular weight: 48 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay:1/1562500.

Target

  • Function
    Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.
  • Sequence similarities
    Belongs to the CTF/NF-I family.
    Contains 1 CTF/NF-I DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • 1110019L22Rik antibody
    • 1500041O16Rik antibody
    • AA589446 antibody
    • AI746521 antibody
    • CAAT box transcription factor antibody
    • CCAAT binding transcription factor antibody
    • CCAAT box binding transcription factor antibody
    • CCAAT-box-binding transcription factor antibody
    • CNFI C antibody
    • CTF antibody
    • CTF5 antibody
    • MGC137374 antibody
    • MGC20153 antibody
    • NF I antibody
    • NF I/C antibody
    • NF-I/C antibody
    • NF1 C antibody
    • NF1-C antibody
    • NF1C antibody
    • NFI antibody
    • NFI-C antibody
    • NFI/C antibody
    • NFIC antibody
    • NFIC_HUMAN antibody
    • Nuclear factor 1 antibody
    • Nuclear factor 1 C type antibody
    • Nuclear factor 1 C-type antibody
    • Nuclear factor 1/C antibody
    • Nuclear factor I/C (CCAAT binding transcription factor) antibody
    • Nuclear factor I/C antibody
    • TGGCA binding protein antibody
    • TGGCA-binding protein antibody
    • Transcription factor NFIC antibody
    see all

Images

  • Lane 1 : markers
    Lane 2 : Anti-NFIC antibody (ab48948) at 2.5 µg/ml

    Lane 1 : markers
    Lane 2 : HepG2 cell lysate at 10 µg

    Secondary
    Lane 1 : markers
    Lane 2 : HRP conjugated anti-Rabbit IgG at 1/50,000 -1/100,000 dilution


    Predicted band size : 48 kDa
    Observed band size : 48 kDa

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab48948.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up