
  • Product name
  • Description
    Rabbit polyclonal to NFIC
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide (human). The exact amino acid sequence is considered to be commercially sensitive but was derived from the following sequence: VRERDAEQSGSPRTGMGSDQEDSKPITLDTTDFQESFVT SGVFSVTELIQ

  • Positive control
    • HepG2 cell lysate



Our Abpromise guarantee covers the use of ab48948 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2.5 µg/ml. Detects a band of approximately 48 kDa (predicted molecular weight: 48 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay:1/1562500.


  • Function
    Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.
  • Sequence similarities
    Belongs to the CTF/NF-I family.
    Contains 1 CTF/NF-I DNA-binding domain.
  • Cellular localization
  • Information by UniProt
  • Database links
  • Alternative names
    • 1110019L22Rik antibody
    • 1500041O16Rik antibody
    • AA589446 antibody
    • AI746521 antibody
    • CAAT box transcription factor antibody
    • CCAAT binding transcription factor antibody
    • CCAAT box binding transcription factor antibody
    • CCAAT-box-binding transcription factor antibody
    • CNFI C antibody
    • CTF antibody
    • CTF5 antibody
    • MGC137374 antibody
    • MGC20153 antibody
    • NF I antibody
    • NF I/C antibody
    • NF-I/C antibody
    • NF1 C antibody
    • NF1-C antibody
    • NF1C antibody
    • NFI antibody
    • NFI-C antibody
    • NFI/C antibody
    • NFIC antibody
    • NFIC_HUMAN antibody
    • Nuclear factor 1 antibody
    • Nuclear factor 1 C type antibody
    • Nuclear factor 1 C-type antibody
    • Nuclear factor 1/C antibody
    • Nuclear factor I/C (CCAAT binding transcription factor) antibody
    • Nuclear factor I/C antibody
    • TGGCA binding protein antibody
    • TGGCA-binding protein antibody
    • Transcription factor NFIC antibody
    see all

Anti-NFIC antibody images

  • Lane 1 : markers
    Lane 2 : Anti-NFIC antibody (ab48948) at 2.5 µg/ml

    Lane 1 : markers
    Lane 2 : HepG2 cell lysate at 10 µg

    Lane 1 : markers
    Lane 2 : HRP conjugated anti-Rabbit IgG at 1/50,000 -1/100,000 dilution

    Predicted band size : 48 kDa
    Observed band size : 48 kDa

References for Anti-NFIC antibody (ab48948)

This product has been referenced in:

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab48948.
Please use the links above to contact us or submit feedback about this product.


Sign up