Overview

  • Product name
  • Description
    Rabbit polyclonal to NFKBID
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment within Human NFKBID aa 1-221. The exact sequence is proprietary. (With tag).
    Sequence:

    MEAGPWRVSAPPSGPPQFPAVVPGPSLEVARAHMLALGPQQLLAQDEEGD TLLHLFAARGLRWAAYAAAEVLQVYRRLDIREHKGKTPLLVAAAANQPLI VEDLLNLGAEPNAADHQGRSVLHVAATYGLPGVLLAVLNSGVQVDLEARD FEGLTPLHTAILALNVAMRPSDLCPRVLSTQARDRLDCVHMLLQMGANHT SQEIKSNKTVLHLAVQAANPT


    Database link: Q8NI38

  • Positive control
    • HeLa and 231 cell lysates; Human tonsil tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab182633 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/25 - 1/100.
WB 1/500 - 1/2000. Predicted molecular weight: 33 kDa.

Target

  • Function
    May regulate the expression of IL-2, IL-6, and other cytokines through regulation on NF-kappa-B activity. Functions in the regulation of inflammatory responses. May also regulate TCR-induced negative selection of thymocytes.
  • Sequence similarities
    Belongs to the NF-kappa-B inhibitor family.
    Contains 6 ANK repeats.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • I-kappa-B-delta antibody
    • IkappaBdelta antibody
    • IkappaBNS antibody
    • IkB-delta antibody
    • IKBD_HUMAN antibody
    • IKBNS antibody
    • NF-kappa-B inhibitor delta antibody
    • NFKBID antibody
    • Nuclear factor of kappa light polypeptide gene enhancer in B cells inhibitor delta antibody
    • T-cell activation NFKB-like protein antibody
    • TA-NFKBH antibody
    see all

Images

  • All lanes : Anti-NFKBID antibody (ab182633) at 1/450 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : 231 cell lysate

    Lysates/proteins at 40 µg per lane.

    Secondary
    All lanes : Goat anti Rabbit IgG - H&L (HRP) at 1/10000 dilution

    Predicted band size: 33 kDa


    Exposure time: 2 minutes
  • Immunohistochemical analysis of paraffin-embedded Human tonsil tissue labeling NFKBID with ab182633 at 1/25 dilution (left panel). Right panel treated with the immunogen.

References

ab182633 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182633.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up