Overview

  • Product nameAnti-NIPAL2 antibody
  • Description
    Rabbit polyclonal to NIPAL2
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Rabbit
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids

    AAVAPAGPGDSASAALDELSLNFTYGAPGAGNGSLSGDWYRRNQIHLFGV

    ) of Human NIPAL2. NP_079035

  • Positive control
    • Placenta lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab81362 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 41 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1/12500.

Target

  • RelevanceNPAL2 is a multi-pass membrane protein and it belongs to the NIPA family. The exact function of NPAL2 remains unknown.
  • Cellular localizationMembrane; Multi-pass membrane protein
  • Database links
  • Alternative names
    • NIPA like domain containing 2 antibody
    • NIPAL2 antibody
    • NPAL2 antibody

Anti-NIPAL2 antibody images

  • Anti-NIPAL2 antibody (ab81362) at 1 µg/ml + placenta lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 41 kDa
    Observed band size : 38 kDa (why is the actual band size different from the predicted?)

References for Anti-NIPAL2 antibody (ab81362)

ab81362 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81362.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"