Overview

  • Product nameAnti-NIRF antibody
    See all NIRF primary antibodies
  • Description
    Rabbit polyclonal to NIRF
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Human
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 24 - 73 (TIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFDYDVGLNDIIQLL V) of Mouse NIRF (NP_659122).

  • Positive control
    • Mouse pancreas lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab116078 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 90 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionE3 ubiquitin-protein ligase which mediates ubiquitination and subsequent proteasomal degradation of PCNP. May participate in methylation-dependent transcriptional regulation. Important for G1/S transition. Overexpression causes G1 phase cell arrest.
  • PathwayProtein modification; protein ubiquitination.
  • Sequence similaritiesContains 1 PHD-type zinc finger.
    Contains 2 RING-type zinc fingers.
    Contains 1 ubiquitin-like domain.
    Contains 1 YDG domain.
  • Post-translational
    modifications
    May be autoubiquitinated; which may lead to proteasomal degradation.
    Phosphorylated. Phosphorylation may be mediated by CDK2.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • DKFZp434B0920 antibody
    • DKFZp686G0837 antibody
    • E3 ubiquitin-protein ligase UHRF2 antibody
    • MGC33463 antibody
    • Np95 like RING finger protein antibody
    • Np95-like ring finger protein antibody
    • Np95/ICBP90 like RING finger protein antibody
    • Np95/ICBP90-like RING finger protein antibody
    • Nuclear protein 97 antibody
    • Nuclear zinc finger protein Np97 antibody
    • RING finger protein 107 antibody
    • RNF 107 antibody
    • RP11-472F14.2 antibody
    • Ubiquitin like containing PHD and RING finger domains protein 2 antibody
    • Ubiquitin-like PHD and RING finger domain-containing protein 2 antibody
    • Ubiquitin-like-containing PHD and RING finger domains protein 2 antibody
    • Uhrf2 antibody
    • UHRF2_HUMAN antibody
    • URF 2 antibody
    see all

Anti-NIRF antibody images

  • Anti-NIRF antibody (ab116078) at 1 µg/ml + Mouse pancreas lysate at 10 µg

    Predicted band size : 90 kDa

References for Anti-NIRF antibody (ab116078)

ab116078 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116078.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"