Overview

  • Product name
  • Description
    Mouse polyclonal to NIRF
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Fusion protein:

    LGAWFEAHIHSVTRASDGQSRGKTPLKNGSSCKRTNGNIKHKSKENTNKL DSVPSTSNSDCVAADEDVIYHIQYDEYPESGTLEMNVKDLRPRARTILKW

    , corresponding to amino acids 140/239 of Human NIRF

  • General notes
    Produced from outbred CD1 mice


    This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer
    Constituents: 50% Glycerol
  • Purity
    Whole antiserum
  • Primary antibody notes
    This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab22235 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 90 kDa.

This antibody has been tested in Western blot against an E.coli lysate containing the partial recombinant fusion protein used as an immunogen. We have no data on detection of endogenous protein.

Target

  • Function
    E3 ubiquitin-protein ligase which mediates ubiquitination and subsequent proteasomal degradation of PCNP. May participate in methylation-dependent transcriptional regulation. Important for G1/S transition. Overexpression causes G1 phase cell arrest.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 PHD-type zinc finger.
    Contains 2 RING-type zinc fingers.
    Contains 1 ubiquitin-like domain.
    Contains 1 YDG domain.
  • Post-translational
    modifications
    May be autoubiquitinated; which may lead to proteasomal degradation.
    Phosphorylated. Phosphorylation may be mediated by CDK2.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • DKFZp434B0920 antibody
    • DKFZp686G0837 antibody
    • E3 ubiquitin-protein ligase UHRF2 antibody
    • MGC33463 antibody
    • Np95 like RING finger protein antibody
    • Np95-like ring finger protein antibody
    • Np95/ICBP90 like RING finger protein antibody
    • Np95/ICBP90-like RING finger protein antibody
    • Nuclear protein 97 antibody
    • Nuclear zinc finger protein Np97 antibody
    • RING finger protein 107 antibody
    • RNF 107 antibody
    • RP11-472F14.2 antibody
    • Ubiquitin like containing PHD and RING finger domains protein 2 antibody
    • Ubiquitin-like PHD and RING finger domain-containing protein 2 antibody
    • Ubiquitin-like-containing PHD and RING finger domains protein 2 antibody
    • Uhrf2 antibody
    • UHRF2_HUMAN antibody
    • URF 2 antibody
    see all

Anti-NIRF antibody images

  • All lanes : Anti-NIRF antibody (ab22235) at 1/1000 dilution

    Lane 1 : Total protein extract from E. coli with ~50ng to 100ng of a negative control fusion protein with an irrelevant antigen at 20 ug
    Lane 2 : Total protein extract from E. coli with ~50ng to 500ng of the antigen fusion protein at 20 ug

    Secondary
    Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at 1/5000 dilution

    Predicted band size : 90 kDa

References for Anti-NIRF antibody (ab22235)

ab22235 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab22235.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up