Overview

  • Product name
    Anti-NKAIN4 antibody
  • Description
    Rabbit polyclonal to NKAIN4
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 2-51 (GSCSGRCALVVLCAFQLVAALERQVFDFLGYQWAPILANFVHIIIVILG L) of Human NKAIN4 (NP_690603).

  • Positive control
    • HepG2 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab87299 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 23 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Information by UniProt
  • Database links
  • Alternative names
    • AB030182 antibody
    • bA261N11.2 antibody
    • C030019F02Rik antibody
    • C20orf58 antibody
    • Chromosome 20 open reading frame 58 antibody
    • FAM77A antibody
    • MGC102050 antibody
    • Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 4 antibody
    • Na+/K+ transporting ATPase interacting 4 antibody
    • NKAI4_HUMAN antibody
    • nkain4 antibody
    • Nkain4 Na+/K+ transporting ATPase interacting 4 antibody
    • OTTHUMP00000031539 antibody
    • Protein FAM77A antibody
    • RGD1305809 antibody
    • RP23-359C15.9 antibody
    • Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4 antibody
    see all

Images

  • Anti-NKAIN4 antibody (ab87299) at 1 µg/ml + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 23 kDa
    Observed band size : 25 kDa (why is the actual band size different from the predicted?)

References

ab87299 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab87299.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up