Overview

  • Product name
  • Description
    Rabbit polyclonal to NKG2D
  • Specificity
    This antibody detects endogenous levels of NKG2D protein.
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human NKG2D.
    Sequence:

    MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENA SPFFFCCFIA VAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGP CPKNWICYKNNCYQFFDESKNW YESQASCMSQNASLLKVYSKEDQDLL KLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLT IIEMQKGDCALYAS SFKGYIENCSTPNTYICMQRTV


    Database link: P26718

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.1% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    purity is > 95% (by SDS-PAGE).
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab192524 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 26 kDa.

Target

  • Function
    Receptor for MICA, MICB, ULBP1, ULBP2, ULBP3 (ULBP2>ULBP1>ULBP3) and ULBP4. Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. Involved in the immune surveillance exerted by T- and B-lymphocytes.
  • Tissue specificity
    Natural killer cells. Expressed on essentially all CD56+CD3- NK cells from freshly isolated PBMC. Also detected in gamma-delta cells and CD8+ alpha-beta T-cells. Expressed in interferon-producing killer dendritic cells (IKDCs).
  • Sequence similarities
    Contains 1 C-type lectin domain.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CD314 antibody
    • CD314 antigen antibody
    • D12S2489E antibody
    • Killer cell lectin like receptor subfamily K member 1 antibody
    • Killer cell lectin-like receptor subfamily K member 1 antibody
    • KLR antibody
    • KLRC4 KLRK1 readthrough antibody
    • KLRK1 antibody
    • NK cell receptor D antibody
    • NK lectin-like receptor antibody
    • NKG2 D activating NK receptor antibody
    • NKG2 D type II integral membrane protein antibody
    • NKG2-D antibody
    • NKG2-D type II integral membrane protein antibody
    • NKG2-D-activating NK receptor antibody
    • Nkg2d antibody
    • NKG2D_HUMAN antibody
    • NKLLR antibody
    • NKR P2 antibody
    • Nkrp2 antibody
    see all

References

ab192524 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192524.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up