Anti-Nkx2.5 antibody [MM0839-5Z56] (ab201654)

Overview

  • Product name
    Anti-Nkx2.5 antibody [MM0839-5Z56]
    See all Nkx2.5 primary antibodies
  • Description
    Mouse monoclonal [MM0839-5Z56] to Nkx2.5
  • Host species
    Mouse
  • Tested applications
    Suitable for: ELISA, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Nkx2.5 aa 24-137.
    Sequence:

    QRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAEL GRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELE KTEADNAERPRARR


    Database link: P52952

Properties

Applications

Our Abpromise guarantee covers the use of ab201654 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.
IHC-P 1/50 - 1/100.
WB 1/1000 - 1/2000. Predicted molecular weight: 35 kDa.

Target

  • Function
    Implicated in commitment to and/or differentiation of the myocardial lineage. Acts as a transcriptional activator of ANF in cooperation with GATA4 (By similarity). It is transcriptionally controlled by PBX1 and acts as a transcriptional repressor of CDKN2B (By similarity). It is required for spleen development.
  • Tissue specificity
    Expressed only in the heart.
  • Involvement in disease
    Atrial septal defect 7, with or without atrioventricular conduction defects
    Tetralogy of Fallot
    Conotruncal heart malformations
    Hypothyroidism, congenital, non-goitrous, 5
    Ventricular septal defect 3
    Hypoplastic left heart syndrome 2
    Asplenia, isolated congenital
  • Sequence similarities
    Belongs to the NK-2 homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • NKX2.5, mouse, homolog of antibody
    • Cardiac-specific homeobox 1 antibody
    • Cardiac-specific homeobox antibody
    • CHNG5 antibody
    • CSX antibody
    • CSX1 antibody
    • FLJ52202 antibody
    • FLJ97166 antibody
    • FLJ97195 antibody
    • FLJ97197 antibody
    • FLJ99536 antibody
    • HLHS2 antibody
    • Homeobox protein CSX antibody
    • Homeobox protein NK-2 homolog E antibody
    • Homeobox protein Nkx 2.5 antibody
    • Homeobox protein Nkx-2.5 antibody
    • NK2 homeobox 5 antibody
    • NK2 transcription factor related locus 5 antibody
    • NK2 transcription factor related, locus 5 (Drosophila) antibody
    • NK2, Drosophila, homolog of, E antibody
    • NKX2-5 antibody
    • NKX2.5 antibody
    • NKX25_HUMAN antibody
    • Nkx2E antibody
    • NKX4-1 antibody
    • Tinman paralog antibody
    • VSD3 antibody
    see all

References

ab201654 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201654.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up