Anti-nkx6.2 antibody - N-terminal (ab179532)

Overview

  • Product name
    Anti-nkx6.2 antibody - N-terminal
    See all nkx6.2 primary antibodies
  • Description
    Rabbit polyclonal to nkx6.2 - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Guinea pig, Dog
  • Immunogen

    Synthetic peptide within Human nkx6.2 aa 15-64 (N terminal). The exact sequence is proprietary.
    Sequence:

    PLAALHNMAEMKTSLFPYALQGPAGFKAPALGGLGAQLPLGTPHGISDIL


    Database link: Q9C056

  • Positive control
    • Esophagus tumor tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab179532 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 29 kDa.

Target

Images

  • Anti-nkx6.2 antibody - N-terminal (ab179532) at 1 µg/ml + Esophagus tumor tissue lysate at 10 µg

    Predicted band size: 29 kDa

References

ab179532 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Frozen sections)
Sample
Mouse Tissue sections (Embryonic spinal cord)
Permeabilization
Yes - 0.1%Triton X-100
Specification
Embryonic spinal cord
Blocking step
Serum as blocking agent for 30 minute(s) · Concentration: 10% · Temperature: 20°C
Fixative
Paraformaldehyde
Username

Dr. Frederic Clotman

Verified customer

Submitted Jun 10 2016

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up