Overview

  • Product nameAnti-NME4 antibody
    See all NME4 primary antibodies
  • Description
    Rabbit polyclonal to NME4
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to internal sequence amino acids 107-156 (VAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDS V) of Human NME4 (NP 005000)

  • Positive control
    • Human fetal heart lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab98198 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 21 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMajor role in the synthesis of nucleoside triphosphates other than ATP.
  • Tissue specificityWidely distributed. Found at very high levels in prostate, heart, liver, small intestine, and skeletal muscle tissues, and in low amounts in the brain and in blood leukocytes.
  • Sequence similaritiesBelongs to the NDK family.
  • Cellular localizationMitochondrion intermembrane space.
  • Information by UniProt
  • Database links
  • Alternative names
    • metastatic inhibition factor NM23H4 antibody
    • mitochondrial antibody
    • NDK antibody
    • NDKM_HUMAN antibody
    • NDP kinase antibody
    • NDP kinase D antibody
    • NDP kinase, mitochondrial antibody
    • NDPK D antibody
    • NDPKD antibody
    • nm23 H4 antibody
    • nm23-H4 antibody
    • NM23D antibody
    • NM23H4 antibody
    • Nm23M4 antibody
    • NME/NM23 nucleoside diphosphate kinase 4 antibody
    • NME4 antibody
    • Non metastatic cells 4 protein expressed in antibody
    • Non metastatic protein 23, homolog 4 antibody
    • Nucleoside diphosphate kinase D antibody
    • Nucleoside diphosphate kinase, mitochondrial antibody
    • Nucleoside diphosphate kinase, mitochondrial antibody
    see all

Anti-NME4 antibody images

  • Anti-NME4 antibody (ab98198) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal heart lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 21 kDa

References for Anti-NME4 antibody (ab98198)

ab98198 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98198.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"